KEGG   Streptomyces pratensis: Sfla_3414Help
Entry
Sfla_3414         CDS       T01647                                 

Definition
(GenBank) acetate/CoA ligase
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
sfa  Streptomyces pratensis
Pathway
sfa00010  Glycolysis / Gluconeogenesis
sfa00620  Pyruvate metabolism
sfa00640  Propanoate metabolism
sfa00680  Methane metabolism
sfa01100  Metabolic pathways
sfa01110  Biosynthesis of secondary metabolites
sfa01120  Microbial metabolism in diverse environments
sfa01130  Biosynthesis of antibiotics
sfa01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:sfa00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Sfla_3414
   00620 Pyruvate metabolism
    Sfla_3414
   00640 Propanoate metabolism
    Sfla_3414
  Energy metabolism
   00680 Methane metabolism
    Sfla_3414
Enzymes [BR:sfa01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     Sfla_3414
Lipid biosynthesis proteins [BR:sfa01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   Sfla_3414
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C ACAS_N BAT
Motif
Other DBs
NCBI-ProteinID: ADW04835
UniProt: E8WF63
Position
complement(3938721..3940688)
Genome map
AA seq 655 aa AA seqDB search
MGDVVSNESLANLLKEERRFAPPADLAANANVTVEAYEQAEADRLGFWAEQARRLSWATE
PTETLDWSNPPFAKWFADGKLNVAYNCVDRHVEAGNGDRVAIHFEGEPGDSRAITYAELK
DEVSRAANALTELGVGKGDRVAVYLPMIPEAAVAMLACARIGAAHSVVFGGFSADAIAAR
IQDADAKVVITSDGGYRRGKPSALKPAVDDAVSRIDSVEHVLVVRRTGQDTAWTEGRDVW
WHEITGRQSAEHTPEAFEAEQPLFILYTSGTTGKPKGILHTSGGYLTQAAYTHHAVFDLK
PETDVYWCTADIGWVTGHSYIVYGPLANGATQVMYEGTPDTPHQGRFWEIVQKYGVTILY
TAPTAIRTFMKWGDDIPAKFDLTSLRVLGSVGEPINPEAWIWYRKNIGADTCPIVDTWWQ
TETGAMMISPLPGVTPTKPGSAQRALPGISATVVDDEANEVPNGGGGYLVLTEPWPSMLR
TIWGDDQRFIDTYWSRFEGKYFAGDGAKKDEDGDIWLLGRVDDVMLVSGHNISTTEVESA
LVSHPAVAEAAVVGANDETTGQAIVAFVILRGTATASEELVAELRNHVGTTLGPIAKPKR
VLPVAELPKTRSGKIMRRLLRDVAENRELGDVTTLTDSSVMALIQTQLPSASSDD
NT seq 1968 nt NT seq  +upstreamnt  +downstreamnt
atgggagatgtcgtgagcaacgaaagcttggccaatctgctcaaggaggagcggcggttc
gcaccgcctgccgatctggccgcgaacgccaacgtgacggtggaggcgtacgagcaggcc
gaagcggacaggctgggcttctgggccgagcaggcccgccgcctcagctgggccaccgag
ccgacggagacgctcgactggagcaatccgcccttcgccaagtggttcgccgacggcaag
ctcaacgtcgcgtacaactgcgtggaccgccacgtcgaggcgggcaacggcgaccgggtc
gcgatccatttcgagggcgagcccggcgacagccgtgcgatcacctatgccgagctgaag
gacgaggtctcccgcgcggcgaacgcactcaccgaactcggcgtgggcaagggagaccgg
gtcgcggtctacctgccgatgatccctgaggccgccgtggcgatgctggcctgcgcccgt
atcggggcagcgcattcggtggtcttcggcggcttctccgcggatgccatcgcagcccgc
atccaggacgccgacgccaaggtcgtcatcacctcggacggcggctaccggcgcggcaag
ccctcggcactgaagccggccgtggacgacgccgtttcccgtatcgacagcgtcgagcac
gtcctggtggtccgtcgcaccggtcaggacaccgcctggaccgagggccgagacgtgtgg
tggcacgagatcaccggccggcagtcggccgagcacactcccgaggccttcgaagcggag
cagccgctcttcatcctgtacacctcggggaccacgggtaagcccaagggcatcctgcac
acctccgggggttacctcacccaggcggcgtacacgcaccatgcggtcttcgacctgaag
cccgagaccgacgtgtactggtgcaccgcggacatcggctgggtgaccggccactcctac
atcgtctacggtccgctggccaacggtgcgacgcaggtcatgtacgagggcacacccgac
acgccccaccagggacgcttctgggaaatcgtccagaagtacggcgtcacgatcctctac
accgcgccgaccgcgatccgtacgttcatgaagtggggagacgacatccccgcgaagttc
gacctgacgtccctgcgtgtcctcggctcggtcggtgagccgatcaacccggaagcctgg
atctggtaccgcaagaacatcggcgccgacacctgtcccatcgtggacacctggtggcag
accgagaccggcgccatgatgatctcgcccctcccgggagtcacgccgaccaagcccggt
tcggcccagcgggccctgcccggcatctccgcaaccgtggtcgacgacgaggccaacgag
gtaccgaacggcgggggcggctatctcgtcctcacggagccgtggccgtcgatgctccgc
accatctggggggacgaccagcgcttcatcgacacctactggtcccgcttcgagggcaag
tacttcgcgggcgacggcgccaagaaggacgaggacggtgacatctggctgctcggccgg
gtcgacgacgtcatgctcgtgtccgggcacaacatctcgaccaccgaggtcgagtcggct
ctcgtgtcgcaccccgcggtcgccgaggctgccgtggtcggcgccaacgacgagacgacg
ggtcaggccatcgtggccttcgtgatcctgcgtggcaccgccacagcgtccgaggaactg
gtcgccgagctgcgtaatcacgtcggcaccacgctcggtccgatcgcgaagcccaagcgc
gtccttccggtggccgagctgccgaagacccggtccggcaagatcatgcgccgcctgctc
cgggatgtcgccgagaaccgcgagctgggcgatgtcacgacgctcaccgattcctcggtc
atggctctcatccagacacagctgccctcggcttcgtccgacgactag

DBGET integrated database retrieval system