KEGG   Streptomyces flavogriseus: Sfla_3466Help
Entry
Sfla_3466         CDS       T01647                                 

Definition
GTP cyclohydrolase I
Orthology
K01495  
GTP cyclohydrolase I [EC:3.5.4.16]
Organism
sfa  Streptomyces flavogriseus
Pathway
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:sfa00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
4006469..4007074
Genome map
AA seq 201 aa AA seqDB search
MTDPVTLDGQGSIGVFDEKRAEAAVRELLIAVGEDPDREGLRETPGRVARAYKEIFAGLH
QEPEDVLTTTFDLGHDEMVLVKDIEVFSTCEHHLVPFRGVAHVGYIPATTGKITGLSKLA
RLVDVYARRPQVQERLTTQIAESLMAILEPRGVIVVVECEHMCMSMRGIRKPGAKTLTSA
VRGQLRDPATRAEAMSLIMAR
NT seq 606 nt NT seq  +upstreamnt  +downstreamnt
atgaccgacccggtgacgctcgacgggcagggctcgatcggcgttttcgacgagaagcgg
gccgaggcggctgttcgggagctcctcatcgctgtcggcgaggaccccgaccgtgagggc
ctgcgcgagacgccgggccgagtggcacgtgcgtacaaggagatattcgcgggcctccac
caggagcccgaggacgtcctgacgacgacgttcgatctcggccacgacgagatggtgctg
gtcaaggacatcgaggtgttcagtacctgtgagcaccacctggttccgttccgcggggtc
gcgcacgtgggctacatcccggcgaccaccggcaagatcaccgggctctcgaagctggcg
cggctggtcgacgtctacgcccggcggccgcaggtccaggagcgtctcaccacgcagatc
gccgagtccctgatggcgatcctggagccgcgcggggtcatcgtggtcgtcgagtgcgag
cacatgtgcatgtcgatgcgtggcatccgcaagcccggagcgaagacgctcacgtccgcg
gtccgtggccagctccgtgatccggcgacgcgtgccgaggccatgagcctcatcatggcg
cgctga

DBGET integrated database retrieval system