KEGG   Streptomyces flavogriseus: Sfla_3469Help
Entry
Sfla_3469         CDS       T01647                                 

Definition
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase
Orthology
K00950  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:2.7.6.3]
Organism
sfa  Streptomyces flavogriseus
Pathway
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:sfa00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(4008129..4008740)
Genome map
AA seq 203 aa AA seqDB search
MTAFSTEGQSDPTVQPVPAAVVEQVDAADVTLSNPKRAVISLGSNLGNRLDTIQGAIDAL
EDTPGLRVKAVSPVYETEPWGVDPGSQPSYFNAVIIVKTTLPPSSLLERGQAIEEAFDRV
REERWGPRTIDVDIVSYADVVSDDPLLTLPHPRARERAFVLAPWHDVDPEAQLPGVGPVA
DLLAGVGRDGVLPRPDLELRLPE
NT seq 612 nt NT seq  +upstreamnt  +downstreamnt
atgactgcattttccaccgaggggcagagcgacccgaccgtacagccggttcccgcagcc
gtggtcgagcaggtcgacgcggccgacgtcaccctctccaaccccaaacgggccgtgatc
tccctcggctccaacctcggcaaccgcctggacacgatccagggggccatcgacgccctg
gaggacacccccggcctccgggtcaaggcggtctccccggtctacgagacggagccctgg
ggcgtcgaccccggctcccagccgtcgtacttcaacgcggtcatcatcgtgaagacgacc
ctgcccccctcgtcgctgctggagcgcggccaggccatcgaggaggccttcgaccgggtc
cgggaggagcgctggggcccgcgcaccatcgacgtcgacatcgtgtcgtacgccgacgtg
gtctccgacgacccgctgctgacccttccgcacccgcgcgcccgcgagcgcgccttcgtc
ctcgccccctggcacgacgtggacccggaggcccagctgcccggcgtcggcccggtcgcc
gatcttctggccggtgtcggccgcgacggagtgcttccccggcccgacctggaactccgt
ctccccgagtag

DBGET integrated database retrieval system