KEGG   Streptomyces flavogriseus: Sfla_3553Help
Entry
Sfla_3553         CDS       T01647                                 

Definition
porphobilinogen synthase
Orthology
K01698  
porphobilinogen synthase [EC:4.2.1.24]
Organism
sfa  Streptomyces flavogriseus
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Heme biosynthesis, glutamate => protoheme/siroheme
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:sfa00860]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
4107362..4108357
Genome map
AA seq 331 aa AA seqDB search
MTDYGNFPGSRPRRLRTTPVMRRMVAETRLDPANLILPAFVREGIDAPVAISAMPGVQQH
TLDTLRKAAVDAVAAGVSGIMLFGVPLDEKKDARGTAGTDPEGILQVGLRAVREEVGDDL
VIMSDLCLDEYTDHGHCGVLTEDGRVDNDATLERYAEMAQVQADAGAHVVGPSGMMDGQV
GVIRDALDQTGHEDVSILAYTAKYSSAFYGPFREAVGSSLQGDRKTYQQDPANIRESLRE
LALDLEEGADMVMVKPAGPYLDILAKVADAVDVPVAAYQISGEYAMIEAAAEKGWIDRDA
AILESLTGIRRAGARMILTYWATEVAQKLGR
NT seq 996 nt NT seq  +upstreamnt  +downstreamnt
atgaccgattacggaaacttccccggctcgcggccccgccggctgcggacgacccccgtc
atgcggcgcatggtcgccgagacccggctcgaccctgcgaacctgatcctgcccgcgttc
gtgcgcgagggcatcgacgccccggtcgcgatctcggccatgccgggtgtccagcagcac
accctcgacacgctgcggaaggccgctgtggacgcggtcgcggcgggcgtctcggggatc
atgctcttcggtgtcccgctggacgagaagaaggacgccaggggcacggcgggcaccgat
cctgagggcatcctccaggtcggcctgcgggcggtgcgggaagaggtcggcgacgacctc
gtgatcatgtcggacctctgtctggacgagtacaccgaccacggccactgcggggtgctg
accgaggacggccgcgtcgacaacgacgccacgctggagcggtacgccgagatggcccag
gtccaggcggacgcgggtgcgcacgtggtgggccccagcggcatgatggacggccaggtc
ggagtgatccgcgacgcgctggaccagacgggccacgaggacgtgtcgatcctcgcctac
accgcgaagtactcctcggccttctacggtccgttccgcgaggcggtcggctcctcgctc
cagggcgaccgcaagacgtaccagcaggacccggcgaacatccgcgagtcgctgcgcgag
ctggcgctggacctggaggagggcgccgacatggtcatggtcaagcccgccgggccctac
ctggacatcctcgccaaggtcgccgacgccgtggacgtgccggtcgcggcgtaccagatc
agtggtgagtacgccatgatcgaggccgccgccgagaagggctggatcgaccgggacgcg
gcgatcctggagagcctgacgggcatccggcgcgcgggtgcgcgcatgatcctcacgtac
tgggcgacggaggtcgcgcagaagctcgggcgctga

DBGET integrated database retrieval system