KEGG   Streptomyces pratensis: Sfla_3627Help
Entry
Sfla_3627         CDS       T01647                                 

Definition
(GenBank) Triose-phosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
sfa  Streptomyces pratensis
Pathway
sfa00010  Glycolysis / Gluconeogenesis
sfa00051  Fructose and mannose metabolism
sfa00562  Inositol phosphate metabolism
sfa01100  Metabolic pathways
sfa01110  Biosynthesis of secondary metabolites
sfa01120  Microbial metabolism in diverse environments
sfa01130  Biosynthesis of antibiotics
sfa01200  Carbon metabolism
sfa01230  Biosynthesis of amino acids
Module
sfa_M00002  Glycolysis, core module involving three-carbon compounds
sfa_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:sfa00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Sfla_3627
   00051 Fructose and mannose metabolism
    Sfla_3627
   00562 Inositol phosphate metabolism
    Sfla_3627
Enzymes [BR:sfa01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     Sfla_3627
Exosome [BR:sfa04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   Sfla_3627
  Exosomal proteins of bladder cancer cells
   Sfla_3627
  Exosomal proteins of melanoma cells
   Sfla_3627
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM
Motif
Other DBs
NCBI-ProteinID: ADW05047
UniProt: E8W0E5
Position
complement(4184494..4185315)
Genome map
AA seq 273 aa AA seqDB search
MPAAQNTAQNAAHSPRVTIGVSLKMYFGHHETLNWARSIASLAARHPAVTGGTAELFVLP
AFPALVPVTGILAGTEVRTGAQDLATDDSGPYTGEVSGAHLHEIGARYAEVGHAERRRLF
GEGDTVVAAKTAAALRNGLTPVLCVGELDQVAPAEAAARTVAEAERVLATASHEGPLGPV
VLAYEPQWAIGAPRPASPDHIRTVCESLTGWLSTQPALAGSRVIYGGSAGPGLLTQLGTG
VDGLFLGRFAHDPAAVGRILDETLEGALACPTA
NT seq 822 nt NT seq  +upstreamnt  +downstreamnt
atgcccgccgcgcagaacaccgcgcagaacgccgcgcacagcccccgggtcacgatcggg
gtgagcctgaagatgtacttcggccaccacgagaccctcaactgggcccgcagcatcgcc
tccctcgccgcccggcaccccgccgtcaccggcggcacggccgaactgttcgtgctgccc
gccttccccgcgctcgtcccggtcaccgggatcctggccggtacagaggtgcgcaccggg
gcgcaggacctggccaccgacgactccggtccgtacacgggcgaggtcagcggtgcccac
ctgcacgagatcggtgcccgctacgccgaggtcggccacgcggagcgccgccgcctcttc
ggcgagggcgacacggtcgtcgccgcgaagacggccgccgccctgcgcaacgggctgacc
ccggtgctctgcgtcggcgaactcgaccaggtcgcccccgccgaggcggccgcccgcacg
gtcgccgaggccgaacgcgtcctggccacggcgtcccacgagggccccctcggcccggtc
gtcctcgcgtacgaaccgcagtgggcgatcggcgcgccccggccggcctcccccgaccac
atccgcacggtctgcgagtccctcaccggctggctctccacccagccggccctggcggga
agccgcgtgatctacggcggaagcgcgggccccggcctgctcacccagctgggcaccggc
gtcgacgggctgttcctgggccgcttcgcccacgacccggcagcggtgggacgcatcctc
gacgagacgctggaaggagccctcgcatgtcctacggcctga

DBGET integrated database retrieval system