KEGG   Streptomyces pratensis: Sfla_3627Help
Entry
Sfla_3627         CDS       T01647                                 

Definition
Triose-phosphate isomerase
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
sfa  Streptomyces pratensis
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:sfa00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Sfla_3627
   01230 Biosynthesis of amino acids
    Sfla_3627
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Sfla_3627
   00051 Fructose and mannose metabolism
    Sfla_3627
   00562 Inositol phosphate metabolism
    Sfla_3627
Enzymes [BR:sfa01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     Sfla_3627
Exosome [BR:sfa04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   Sfla_3627
  Exosomal proteins of bladder cancer cells
   Sfla_3627
  Exosomal proteins of melanoma cells
   Sfla_3627
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(4184494..4185315)
Genome map
AA seq 273 aa AA seqDB search
MPAAQNTAQNAAHSPRVTIGVSLKMYFGHHETLNWARSIASLAARHPAVTGGTAELFVLP
AFPALVPVTGILAGTEVRTGAQDLATDDSGPYTGEVSGAHLHEIGARYAEVGHAERRRLF
GEGDTVVAAKTAAALRNGLTPVLCVGELDQVAPAEAAARTVAEAERVLATASHEGPLGPV
VLAYEPQWAIGAPRPASPDHIRTVCESLTGWLSTQPALAGSRVIYGGSAGPGLLTQLGTG
VDGLFLGRFAHDPAAVGRILDETLEGALACPTA
NT seq 822 nt NT seq  +upstreamnt  +downstreamnt
atgcccgccgcgcagaacaccgcgcagaacgccgcgcacagcccccgggtcacgatcggg
gtgagcctgaagatgtacttcggccaccacgagaccctcaactgggcccgcagcatcgcc
tccctcgccgcccggcaccccgccgtcaccggcggcacggccgaactgttcgtgctgccc
gccttccccgcgctcgtcccggtcaccgggatcctggccggtacagaggtgcgcaccggg
gcgcaggacctggccaccgacgactccggtccgtacacgggcgaggtcagcggtgcccac
ctgcacgagatcggtgcccgctacgccgaggtcggccacgcggagcgccgccgcctcttc
ggcgagggcgacacggtcgtcgccgcgaagacggccgccgccctgcgcaacgggctgacc
ccggtgctctgcgtcggcgaactcgaccaggtcgcccccgccgaggcggccgcccgcacg
gtcgccgaggccgaacgcgtcctggccacggcgtcccacgagggccccctcggcccggtc
gtcctcgcgtacgaaccgcagtgggcgatcggcgcgccccggccggcctcccccgaccac
atccgcacggtctgcgagtccctcaccggctggctctccacccagccggccctggcggga
agccgcgtgatctacggcggaagcgcgggccccggcctgctcacccagctgggcaccggc
gtcgacgggctgttcctgggccgcttcgcccacgacccggcagcggtgggacgcatcctc
gacgagacgctggaaggagccctcgcatgtcctacggcctga

DBGET integrated database retrieval system