KEGG   Streptomyces pratensis: Sfla_3703Help
Entry
Sfla_3703         CDS       T01647                                 

Definition
(GenBank) UTP-glucose-1-phosphate uridylyltransferase
  KO
K00963  UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
sfa  Streptomyces pratensis
Pathway
sfa00040  Pentose and glucuronate interconversions
sfa00052  Galactose metabolism
sfa00500  Starch and sucrose metabolism
sfa00520  Amino sugar and nucleotide sugar metabolism
sfa01100  Metabolic pathways
sfa01130  Biosynthesis of antibiotics
Module
sfa_M00362  Nucleotide sugar biosynthesis, prokaryotes
sfa_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:sfa00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Sfla_3703
   00052 Galactose metabolism
    Sfla_3703
   00500 Starch and sucrose metabolism
    Sfla_3703
   00520 Amino sugar and nucleotide sugar metabolism
    Sfla_3703
Enzymes [BR:sfa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     Sfla_3703
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NTP_transferase NTP_transf_3 Glycos_transf_2 IspD
Motif
Other DBs
NCBI-ProteinID: ADW05121
UniProt: E8W1N8
Position
4264991..4265893
Genome map
AA seq 300 aa AA seqDB search
MTQSHPRISKAVIPAAGLGTRFLPATKATPKEMLPVVDKPAIQYVVEEAVAAGLSDVLMI
TGRNKRPLEDHFDRNYELESALTRKGDAERLSRVQESSDLATMHYVRQGDPRGLGHAVLC
AAPHVGDQPFAVLLGDDLIDPRDPLLARMVEIQEREGGSVVALMEVDPAQIHMYGCAATE
ATADGDVVRVTGLVEKPEPAEAPSNLAVIGRYVLDPAVFDILRRTEPGRGGEIQLTDALQ
LLAEDEKIGGPVHGVVFKGRRYDTGDRGDYLRAIVRLACEREDLGPDFRTWLRSFVTEEL
NT seq 903 nt NT seq  +upstreamnt  +downstreamnt
atgactcagtcgcaccccaggatcagcaaagctgttattccagctgcaggtctcggcacc
cggttcctgccggccaccaaggccactcccaaggagatgctgcctgtcgtcgacaagccg
gccatccagtatgtggtcgaggaagccgtcgcggcgggtctctccgacgtactgatgatc
accggccggaacaagcgtccgctggaggaccacttcgaccggaactacgagctggagtcc
gcgctgacccgcaagggagacgcggaacgcctctccagggtccaggagtccagcgacctg
gccaccatgcactacgtacgccagggcgacccgcgcggtctcggccacgccgtcctctgc
gccgcgccgcacgtgggagaccagccgttcgccgtcctcctcggtgacgacctcatcgac
ccgcgcgaccccctgctcgcccggatggtcgagatccaggagcgcgagggcggcagcgtc
gtcgcgctgatggaggtggaccccgcgcagatccacatgtacggctgcgccgccaccgag
gcgaccgccgacggcgacgtcgtccgggtcaccgggctcgtcgagaagcccgaacccgcc
gaggcgcccagcaacctcgccgtcatcggccgctacgtcctggaccccgccgtcttcgac
atactgcgacggaccgagcccggccgcggcggcgagatccagctcacggacgcgctccag
ctgctggccgaggacgagaagatcggcgggccggtgcacggtgtcgtcttcaagggccgc
cggtacgacaccggggaccgtggagactatctgcgtgccattgtcagactcgcgtgcgaa
cgtgaggacctgggaccggacttccggacctggctgcgcagtttcgtcaccgaggagttg
taa

DBGET integrated database retrieval system