KEGG   Streptomyces pratensis: Sfla_3748Help
Entry
Sfla_3748         CDS       T01647                                 

Definition
(GenBank) 4-diphosphocytidyl-2C-methyl-D-erythritol kinase
  KO
K00919  4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
sfa  Streptomyces pratensis
Pathway
sfa00900  Terpenoid backbone biosynthesis
sfa01100  Metabolic pathways
sfa01110  Biosynthesis of secondary metabolites
sfa01130  Biosynthesis of antibiotics
Module
sfa_M00096  C5 isoprenoid biosynthesis, non-mevalonate pathway
Brite
KEGG Orthology (KO) [BR:sfa00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    Sfla_3748
Enzymes [BR:sfa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.148  4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase
     Sfla_3748
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GHMP_kinases_C GHMP_kinases_N
Motif
Other DBs
NCBI-ProteinID: ADW05166
UniProt: E8W2V5
Position
4311337..4312236
Genome map
AA seq 299 aa AA seqDB search
MTRSVTVRVPAKVNVQLAVGAPRPDGFHDLANVFLAVGLYDEVTVTPADTLRVTCEGPDA
AQVPLDTTNLAARAALALAARYGVAPDVHIHIAKDIPVAGGMAGGSADGAAALLACDTLW
GTGASREELLEICAELGSDVPFSLVGGAALGVGRGERLTAVEVGGTFHWVFAVADGGLST
PAVYGEFDRLTAGTDVPEPAASPALLTALRKGDVTALADALGNDLQAAALSLRPSLAGTL
AAGTAAGALAALVSGSGPTTAFLTADEESARKVADALLASGTCRSARVAPSPAPGATVV
NT seq 900 nt NT seq  +upstreamnt  +downstreamnt
atgacccgcagcgtcaccgtccgcgtacccgccaaggtcaacgtgcagctcgcggtgggc
gccccccgccccgacggcttccacgacctggccaacgtcttcctggccgtcggtctgtac
gacgaggtcaccgtcaccccggccgacaccctgcgcgtcacctgcgaaggaccggacgcc
gcccaggtgccgctggacaccacgaacctggcggcccgcgccgccctcgccctcgccgcc
cggtacggcgtcgcgcccgacgtgcacatccatatcgccaaggacatccccgtggccggc
ggcatggcgggcggcagcgccgacggtgccgcggccctgctggcctgcgacaccctgtgg
ggcaccggtgcgagccgggaggaactcctcgagatctgcgccgagttgggcagcgacgtg
ccgttcagcctggtcggcggtgcggccctcggcgtcggccggggcgagcggctgaccgcc
gtcgaggtcggcggcaccttccactgggtgttcgccgtcgccgacggcgggctctccacc
ccggccgtgtacggggagttcgaccgcctgaccgccggcaccgacgtccccgagcccgcc
gcgtcccccgcgctcctgaccgccctgcgcaagggggacgtcaccgcgctcgcggacgcc
ctgggcaacgacctccaggccgcggccctctccctgcgcccctcgctggccggcaccctc
gcggcgggcaccgccgcgggcgccctggccgcgctggtctccgggtcggggccgaccacg
gcgttcctcaccgccgacgaggagtcggcccgaaaggtcgccgacgccctgctggcgtcg
ggcacctgccgcagcgcacgggtcgcgccgtcgcccgctccgggagccaccgtcgtctga

DBGET integrated database retrieval system