KEGG   Streptomyces pratensis: Sfla_3870Help
Entry
Sfla_3870         CDS       T01647                                 

Definition
(GenBank) F420 biosynthesis protein FbiB, C-terminal domain protein
  KO
K12234  coenzyme F420-0:L-glutamate ligase / coenzyme F420-1:gamma-L-glutamate ligase [EC:6.3.2.31 6.3.2.34]
Organism
sfa  Streptomyces pratensis
Pathway
sfa00680  Methane metabolism
sfa01120  Microbial metabolism in diverse environments
Module
sfa_M00378  F420 biosynthesis
Brite
KEGG Orthology (KO) [BR:sfa00001]
 Metabolism
  Energy metabolism
   00680 Methane metabolism
    Sfla_3870
Enzymes [BR:sfa01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.31  coenzyme F420-0:L-glutamate ligase
     Sfla_3870
    6.3.2.34  coenzyme F420-1:gamma-L-glutamate ligase
     Sfla_3870
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: F420_ligase Nitroreductase
Motif
Other DBs
NCBI-ProteinID: ADW05287
UniProt: E8W498
Position
complement(4452914..4454242)
Genome map
AA seq 442 aa AA seqDB search
MSGGPADGAPSYRVWALPGIPEVQQGDDLAKLIAATEPGLVDGDVLLVTSKIVSKAEGRI
VEATDREAAIDAETVRVVARRGTLRIVENRQGLVMAAAGVDASNTPAGTVLLLPEDPDAS
ARAVRDGLRDALGVEVGVVVTDTFGRPWRNGLTDVAIGAAGVKVLDDLRGGTDGYGNPLS
ATVVATADELAAAGDLVKGKASGLPVAVVRGLPHVVADADASGDDGARAMVRVAADDMFR
LGTSEAVREALNLRRTVREFTDEPVDPGAVRRAVAAAVTAPAPHHTTPWRFVLLESQGAR
TRLLDAMRDAWIADLRRDGRSEESVAKRVRRGDVLRNAPYLAVPCLVTDGAHTYGDERRD
TAEREMFVVAAGAGVQNFLVALAGERLGSAWVSSTMFCRSVVREVLDLPDTWDPLGAVAV
GHPEGAAPPRAARDAEAFLTVR
NT seq 1329 nt NT seq  +upstreamnt  +downstreamnt
atgagcggtgggcccgcggacggggcgccctcgtaccgggtgtgggcgctgcccgggatc
cccgaggtgcagcagggcgacgacctcgcgaagctgatcgccgcgacggaaccgggcctg
gtggacggcgacgtcctgctggtcacgtcgaagatcgtctccaaggcggagggccggatc
gtcgaggcgacggaccgggaggcggcgatcgacgccgagaccgtccgggtcgtcgcacgg
cgcgggacgctccggatcgtggagaacaggcagggactcgtcatggccgccgccggcgtc
gacgcgtcgaacactccggcggggacggtgcttctgctgcccgaggacccggacgcctcg
gcccgcgccgtccgggacggtctgcgggacgcgctcggggtcgaggtcggcgtcgtcgtc
acggacaccttcgggcgtccctggcgcaacggtctgacggacgtggcgatcggcgccgcc
ggggtcaaggtgctggacgacctccggggcggcaccgacgggtacggcaatccgctgagc
gccaccgtcgtggccacggccgacgagctggccgccgccggtgacctggtgaagggcaag
gcgtccgggctgccggtcgcggtggtacgcggtcttccccatgtggtggcggacgccgac
gcgtccggggacgacggggcccgggcgatggtgcgggtcgcggccgacgacatgttccgg
ctgggcacgtccgaggcggtgcgggaagccctgaatctccgccgcaccgtgcgggagttc
accgacgaaccggtcgaccccggcgccgtacgccgtgcggtggccgcggcggtcacggcc
cccgcgccccaccacacgaccccctggcggttcgtgctgctggagtcgcagggcgcgcgg
acccggctgctggacgccatgcgcgacgcgtggatcgcggatctgcggcgggacggccgc
agcgaggagtccgtcgcgaagcgggtgcgtcgcggcgacgtgctgcgcaacgccccgtat
ctggcggtgccctgcctcgtgaccgacggcgcgcacacctacggggacgagcgccgggac
accgcggagcgcgagatgttcgtggtcgcggccggcgccggcgtgcagaacttcctggtg
gcgctggcgggtgagcgactcggctcggcgtgggtgtcgtcgacgatgttctgccggtcc
gtggtccgcgaggtcctggacctcccggacacctgggacccgctgggcgcggtggcggtg
gggcatccggagggggcggctccgccacgggcagcacgcgacgccgaggcgttcctcacc
gtgcgctga

DBGET integrated database retrieval system