KEGG   Streptomyces pratensis: Sfla_3937Help
Entry
Sfla_3937         CDS       T01647                                 

Definition
uroporphyrinogen III synthase HEM4
Orthology
K01719  
uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
sfa  Streptomyces pratensis
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Heme biosynthesis, glutamate => protoheme/siroheme
Brite
KEGG Orthology (KO) [BR:sfa00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Sfla_3937
Enzymes [BR:sfa01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     Sfla_3937
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
4554259..4555416
Genome map
AA seq 385 aa AA seqDB search
MHDDDAQHGPLAGFTVGVTAARRAEELGTLLTRRGAAVLHAPALRIVPLADDSELLAATK
DLVDNPPDVVIATTAIGFRGWVEAADGWGIGDELLELLRGIELLARGPKVKGAIRAAGLT
EAWSPQSESMAEVLDRLLEEGVTGRRIALQLHGEPLPGFVESLRAAGAEIVGVPVYRWMP
PEDIAPLDRMLDATVGRGLDALTFTSAPAVASYLNRAETRGILPEVLDALGHDVLTACVG
PVTALPLQAKGIDTVQPERFRLGPLVQVLCAQLPARARALPVAGHRVEIRGHAVLVDGAL
RPVPPAGMALLHTLARRPGWVVSRADLLRALPGNGTDEHAVETAMARLRTALGAPRLIQT
VVKRGYRLALDPSADTKYDAVRPGG
NT seq 1158 nt NT seq  +upstreamnt  +downstreamnt
atgcacgacgacgacgcacagcacgggcccctggcgggcttcacggtcggggtgaccgca
gcccgtcgcgccgaggagctcgggacgctcctcacgcgcaggggcgccgcggtcctgcac
gcgcccgcgctgcggatcgttccgctcgcggacgacagcgaactcctggccgcgaccaag
gatctcgtcgacaacccgccggacgtggtgatcgcgaccaccgccatcggtttcaggggc
tgggtggaggccgccgacggctggggcatcggtgacgagctcctcgaactgctgcgcggc
atagagctgctggcccgtggcccgaaggtcaagggcgccatccgggcggccgggctcacc
gaggcgtggtcgccgcagtcggagtcgatggcggaggtcctggaccggctgctggaggag
ggtgtgacgggccgccggatcgcactccagctgcacggcgaaccccttccgggcttcgtc
gagtcgctccgggcggcgggcgccgagatcgtcggcgtacccgtctaccggtggatgccc
ccggaggacatcgccccgctcgaccgcatgctcgacgccaccgtcggccgcggcctggac
gccctcaccttcaccagcgctcccgccgtcgcctcctacctgaaccgggcggagacccgc
ggcatccttcccgaggtgctggacgcactgggccacgacgtcctcacggcgtgcgtcgga
ccggtcaccgccctgcccctgcaggccaagggcatcgacaccgtgcagccggagcggttc
cggctcggacccctcgtccaggtgctctgcgcccagttgccggcccgggcccgcgcgctc
ccggtcgccggccaccgggtcgagatccgcggccacgccgtgctcgtcgacggggccctg
cgcccggtgcccccggccggcatggcgctgctgcacacgctcgcccgccggccgggctgg
gtggtctcccgcgccgacctgctgcgggccctgcccggcaacggaaccgacgagcacgcg
gtggagacggcgatggcccggctgcgcacggcactcggggccccgcggctgatccagacg
gtcgtcaagcggggctaccggctcgccctggacccctccgcggacaccaagtacgacgcg
gtccggcccggcggctag

DBGET integrated database retrieval system