KEGG   Streptomyces pratensis: Sfla_3951Help
Entry
Sfla_3951         CDS       T01647                                 

Definition
beta-N-acetylhexosaminidase
Orthology
K12373  
hexosaminidase [EC:3.2.1.52]
Organism
sfa  Streptomyces pratensis
Pathway
Other glycan degradation
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:sfa00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    Sfla_3951
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    Sfla_3951
Enzymes [BR:sfa01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     Sfla_3951
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
4569700..4571340
Genome map
AA seq 546 aa AA seqDB search
MHHLIPAPRRADGDGGRGFVPDGATTITAGPGTGGTERWLRATLGAAFGLPLAPGTVGAE
EAAGTIELRIDPALEPEGYRLTVVPDRGVRITGGSEAGVFWGAQTLRQLLGPEAFRRAPV
GQGAARGIPATEIEDGPRFGWRGLMLDVARHFTPKDDVLRMLDLLAAHKLNVFHFHLTDD
QGWRVEIKRYPRLTEVGAWRARTKYGHRASELWDETPHGGFYTQDDIREIVAYAAERHIR
VVPEIDIPGHSQAAVSAYPELGNTDVVDTSALSVWDTWGVNPNVLAPTDHTLRFFEGVFE
ELLDLFPADTSPFIHVGGDECPKDQWRQSPTAQARIAELGLKDEDELQSWFIRHFDRWLT
DRGRRLIGWDEILEGGIAEGAAVSSWQGYAGGIAAAEAGHDVVMCPLQQVYLDYRQDAGP
DEPMPIGYVRTLEDVYRFEPVPPGLSEEAAGHVLGTQVNVWTEVMQNRQRVDYQVFPRLA
AFAEVAWSRLPAPGERDFAGFERRMETHYARLDALGVDYRPPTGPLPWQRRPGVLGRPIE
GPPPIV
NT seq 1641 nt NT seq  +upstreamnt  +downstreamnt
atgcaccacctgattccggcgccccggcgcgccgacggcgacggcggtcgcggcttcgtc
cccgacggggccacgaccatcacggccggacccggcaccggcggtacggaacgctggcta
cgcgccacgctcggagcggccttcggcctgccgctcgcccccgggaccgtgggcgccgag
gaggccgccggcaccatcgagctgcggatcgaccccgccctggagccggagggctaccgc
ctcaccgtggtgcccgaccggggcgtgcggatcaccggggggagcgaggcgggcgtgttc
tggggcgcccagaccctgcgccagctcctcggtcccgaggcgttccgcagggcgcccgtg
gggcagggggcggccaggggaattcccgccaccgagatcgaggacggcccgcgcttcggc
tggcgcggtctgatgctcgacgtggcacggcacttcacgcccaaggacgacgtgctgcgc
atgctcgacctgctggccgcgcacaaactgaacgtcttccatttccacctcaccgacgac
cagggctggcgcgtcgagatcaagcgctatccccgtctcacggaggtcggagcctggcgc
gcacggaccaaatacggccaccgcgcctcggaactctgggacgagacaccgcacggcggc
ttctacacccaggacgacatccgcgaaatcgtggcctacgccgccgagaggcatatccgg
gtcgtccccgaaatcgacatcccgggccactcgcaggcagccgtcagcgcgtatccggaa
ctcggcaacaccgacgtcgtcgacacctccgccctttccgtgtgggacacctggggcgtc
aatccgaacgtactcgcccccaccgaccacaccctgcgtttcttcgagggcgtcttcgag
gaattgctcgacctcttcccggccgacacctcgccgttcatccatgtcggcggcgacgaa
tgccccaaggaccagtggaggcagtcgcccaccgcgcaggcccgcatcgcggaactcggc
ctgaaggacgaggacgaactccagtcgtggttcatccgccacttcgaccgctggctcacc
gaccggggccgccggctcatcggctgggacgagatcctggagggcggcatcgccgagggc
gccgccgtgtcctcgtggcagggctacgccggagggatcgccgccgccgaggccgggcac
gacgtcgtcatgtgccccttgcagcaggtgtacctggactaccgtcaggacgccggcccc
gacgagccgatgcccatcgggtacgtccgcaccctggaggacgtgtaccgcttcgagccc
gtgccgcccggcctctccgaggaggcggccggacacgtcctgggaacccaggtcaacgtg
tggaccgaggtcatgcagaaccggcagcgcgtcgactaccaggtcttcccgcggctcgcc
gccttcgccgaggtcgcctggtcccggctcccggcccccggcgagcgggacttcgccggc
ttcgaacggcgcatggagacccactacgcccggctcgacgccctgggcgtcgactaccgg
ccgcccaccggcccgctgccgtggcaacgccgtccaggcgtcctgggtcgcccgatcgag
ggaccgcccccgatcgtgtga

DBGET integrated database retrieval system