KEGG   Streptomyces pratensis: Sfla_3978Help
Entry
Sfla_3978         CDS       T01647                                 

Definition
isochorismatase hydrolase
Orthology
K08281  
nicotinamidase/pyrazinamidase [EC:3.5.1.19 3.5.1.-]
Organism
sfa  Streptomyces pratensis
Pathway
Nicotinate and nicotinamide metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sfa00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    Sfla_3978
Enzymes [BR:sfa01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.19  nicotinamidase
     Sfla_3978
    3.5.1.-  
     Sfla_3978
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(4603505..4604089)
Genome map
AA seq 194 aa AA seqDB search
MHRALIVVDVQNDFCEGGSLAVAGGADVAAAITDLIGDAQPGYSHVVATRDHHIDPGDHF
SSAPDFERSWPPHCVAGTEGVGFHPNFAPAVASGAIDTVFDKGAYTAAYSGFEGVDENGT
GLAQWLRDRSVTAVDIVGIATDHCVRATALDAAREGFATHVLLDLTAGVAEGTTARALEE
LRTAGVELSGKPVV
NT seq 585 nt NT seq  +upstreamnt  +downstreamnt
atgcatcgcgccttgatcgtcgtcgacgttcagaacgacttctgcgagggtggcagcctc
gcggtggcgggcggcgccgatgtcgccgccgccatcaccgatctgatcggcgacgcccag
cccggctacagccacgtcgtggccacccgggaccaccacatcgatcccggtgaccacttc
tcctcggcccccgacttcgagcgctcctggccgccgcactgcgtcgccggcacggagggt
gtgggcttccaccccaatttcgcccccgcggtcgcctccggggcgatcgacaccgtcttc
gacaagggtgcgtacaccgcggcgtacagcgggttcgagggcgtcgacgagaacggcacc
gggctcgcccagtggctgcgggaccgttccgtcaccgcggtcgacatcgtcggcatcgcc
acggaccactgtgtgcgggccaccgccctggacgccgcccgcgagggtttcgccacgcat
gtgctgctggacctgacggccggggtcgccgagggaaccaccgcgcgggccctggaggag
ctgcgcaccgcgggtgtggagctgtcgggcaagccggtcgtctga

DBGET integrated database retrieval system