KEGG   Streptomyces pratensis: Sfla_4140Help
Entry
Sfla_4140         CDS       T01647                                 

Definition
agmatinase
Orthology
K01480  
agmatinase [EC:3.5.3.11]
Organism
sfa  Streptomyces pratensis
Pathway
Arginine and proline metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sfa00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    Sfla_4140
Enzymes [BR:sfa01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.11  agmatinase
     Sfla_4140
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
4770513..4771481
Genome map
AA seq 322 aa AA seqDB search
MSSNETPRGPVDSSRIPRYAGPATFARLPRLDEVGSADVAVVGVPFDTGVSYRPGARFGG
NAIREASRLLRPYNPAQDASPFALAQVADAGDIAANPFDINEAVETVEAAADGLLATGAR
LMTLGGDHTIALPLLRSVAKKHGPVALLHFDAHLDTWDTYFGAEYTHGTPFRRAVEEGIL
DTEALSHVGTRGPLYGKQDLTDDAKMGFGIVTSADVMRRGVDEIADQLRQRIGDRPLYIS
IDIDVLDPAHAPGTGTPEAGGLTSRELLEILRGLSSCHLVSADLVEVAPAYDHAEITSVA
ASHTAYELTTIMSRQIAEGRTK
NT seq 969 nt NT seq  +upstreamnt  +downstreamnt
atgagcagcaacgagacgccgcgcggccccgtcgactcctcccgcatcccgcggtacgcc
ggacccgcgacgttcgcccggctgccacggctcgacgaggtcggctccgccgacgtcgcc
gtcgtcggcgtgcccttcgacaccggtgtctcctaccgccccggcgcccgcttcggcggc
aacgccatccgggaggcctcgcgcctcctgcgcccctacaacccggcgcaggacgcctcg
cccttcgccctcgcccaggtcgccgacgccggtgacatcgccgcgaaccccttcgacatc
aacgaggccgtcgagaccgtcgaggccgccgccgacggcctgctcgcgaccggcgcccgg
ctgatgacgctcggcggcgaccacaccatcgcgctgcccctgctgcgttccgtcgccaag
aagcacgggcccgtcgccctgctgcacttcgacgcgcacctggacacctgggacacctac
ttcggggcggagtacacccacggaaccccgttccgccgcgccgtcgaggagggcatcctc
gacacggaggccctgtcccacgtgggcacccgcggcccgctctacggcaagcaggacctc
accgacgacgccaagatgggcttcggcatcgtcacctccgccgacgtcatgcggcgcggt
gtcgacgagatcgccgaccagctgcggcagcgcatcggcgaccgcccgctctacatctcc
atcgacatcgacgtcctggaccccgcgcacgcccccggcaccggcacccccgaggccggc
ggcctcacctcccgcgaactcctggagatcctgcgcggactctcctcctgccacctggtc
tcggccgacctggtcgaggtcgccccggcgtacgatcacgcggagatcacctccgtcgcc
gcctcccacacggcgtacgagctgacgacgatcatgtcccgccagatcgcggagggccgc
accaagtga

DBGET integrated database retrieval system