KEGG   Streptomyces pratensis: Sfla_4175Help
Entry
Sfla_4175         CDS       T01647                                 

Definition
RecD/TraA family helicase
Orthology
K03581  
exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
sfa  Streptomyces pratensis
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:sfa00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    Sfla_4175
Enzymes [BR:sfa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     Sfla_4175
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
4815088..4817319
Genome map
AA seq 743 aa AA seqDB search
MSNSAVLEGVLERITYANEENGYTVARVDTGRGAGDLLTVVGSLLGAQPGESLRMEGRWA
SHPQFGKQFQVDNYTTVLPATIQGIRRYLGSGLIKGIGPVMADRITTHFGVDTLDIIEQH
PKRLVEVPGLGPKRTKMIAAAWEEQKAIKEVMVFLQSVGVSTSIAVRIYKKYEDASISVV
KNQPYRLAADVWGIGFLTADRIAQAVGIPHDSPERVKAGLQYALSQSTDQGHCFLPEERL
IADGVKLLQVDTGLVIDCLAELAQDPEGVVREKVPGPEDGQPVTAVYLVPFHRAEISLAA
QVQRLLRTPEDRMPGFQDVDWDKALGWLAGRTGATLAPEQEAAVRLALTRKVAVLTGGPG
CGKSFTVRSVVELARARNARVVLAAPTGRAAKRLSELTGAEASTVHRLLELKPGGDAAYD
RERPLDADLVVVDEASMLDLLLANKLVKAVAPGAHLLLVGDVDQLPSVGAGEVLRDLLAE
GGPVPAVRLTTIFRQAQKSGVVTNAHRINSGVPPLTQGLDDFFLFVEDETEDAGVLAVDV
AARRIPAKFGLNPRRDVQVLAPMHRGPAGAGHLNGLLQQAITPGRPGLPEKRFGGRVFRV
GDKVTQIRNNYDKGENGVFNGTVGVVTALDADEQRLTVLTDEEEEIAYDFDELDELAHAY
AMTIHRSQGSEYPAVVIPVTTSAWMMLQRNLLYTAVTRAKKLVVLVGSRKAIGQAVRTVS
AGRRCTALDFRLSGGTAEDFPEK
NT seq 2232 nt NT seq  +upstreamnt  +downstreamnt
atgtccaactccgccgtgctcgaaggcgtcctggagcgcatcacctacgccaacgaggag
aacggctacaccgtggcccgcgtcgacacggggcgcggtgcgggggacctgctcaccgtc
gtcggctcgctcctcggtgcccagcccggcgagtccctgcggatggaggggcgttgggcc
tcgcacccgcagttcggcaagcagttccaggtcgacaactacacgacggtcctcccggcg
accatccagggcatccgccgctacctcggatcgggcctgatcaagggcatcgggccggtc
atggccgaccgcatcaccacccacttcggcgtcgacaccctggacatcatcgagcagcac
ccgaagcgcctcgtggaggtgcccggactcggcccgaagcggacgaagatgatcgccgcg
gcctgggaggaacagaaggcgatcaaggaggtcatggtcttcctccagagcgtcggcgtc
tccacctccatcgccgtccgcatctacaagaagtacgaggacgcctcgatctccgtcgtg
aagaaccagccctaccggctggccgccgacgtctggggcatcggattcctcaccgccgac
cgcatcgcgcaggccgtcggcatcccgcacgacagccccgagcgggtcaaggccgggctc
cagtacgccctttcgcagtccaccgaccaggggcactgcttcctgcccgaggagcggctg
atcgccgacggggtgaagctgctccaggtcgacacggggctcgtcatcgactgcctggcc
gagctcgcgcaggacccggagggcgtcgtacgggagaaggtgccgggccccgaggacggt
cagccggtcaccgccgtgtacctggtccccttccaccgcgccgagatctccctggccgcc
caggtgcagcgcctgctgcgcaccccggaggaccggatgcccggcttccaggacgtcgac
tgggacaaggcgctcggctggctcgcggggcgtacgggggccacgctcgcccccgagcag
gaggccgccgtccggctcgcgctcacccggaaggtcgccgtcctcaccggcggccccggc
tgcggcaagtcgttcaccgtccggtccgtggtcgagctggcccgcgcgcggaacgccagg
gtcgtgctcgccgcgcccaccgggcgggcggcgaagaggctctcggagctgaccggcgcg
gaggcctccaccgtgcaccggctgctggagctgaaacccggcggggacgcggcgtacgac
cgcgaacggccgctggacgccgatctggtcgtcgtcgacgaggcgtcgatgctcgatctg
ctgctcgccaacaagctcgtcaaggccgtggcgcccggtgcccacctcctcctggtcggc
gatgtggaccagttgccctcggtcggcgcgggggaggtactgcgcgacctgctggccgag
ggcggacccgtccccgccgtccggctgaccaccatcttccggcaggcccagaagtccggc
gtcgtcaccaacgcccaccgcatcaactccggggtaccgccgctgacccaggggctggac
gacttcttcctgttcgtggaggacgagacggaggacgccggagtgctcgccgtcgatgtc
gccgcccgccgcatccccgcgaagttcggcctgaatccccgccgcgacgtgcaggtcctc
gccccgatgcaccgcggccccgcgggcgccggccatctcaacggactgctccagcaggcc
atcacccccggacgcccgggcctgcccgagaagcggttcggaggccgcgtcttccgggta
ggcgacaaggtgacacagatcaggaacaactatgacaagggggagaacggggtcttcaac
ggcacggtcggtgtcgtgaccgcgctcgacgcggacgagcagaggctgaccgtcctcacg
gacgaggaggaggagatcgcgtacgacttcgacgaactggacgaactggcccacgcgtac
gccatgaccatccaccgctcgcagggcagcgagtatccggcggtcgtcatcccggtcacc
accagcgcctggatgatgctccagcggaacctgctctacaccgccgtgaccagggccaag
aagctggtcgtgctggtcggctcgcgcaaggccatcggccaggcggtccgtaccgtttcc
gcaggcaggcgctgtacggcactggatttccggctcagcggcggtacggcggaagacttc
ccggaaaaatga

DBGET integrated database retrieval system