KEGG   Streptomyces pratensis: Sfla_4230Help
Entry
Sfla_4230         CDS       T01647                                 

Definition
4-alpha-glucanotransferase
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
sfa  Streptomyces pratensis
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sfa00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Sfla_4230
Enzymes [BR:sfa01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.25  4-alpha-glucanotransferase
     Sfla_4230
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
4891039..4893186
Genome map
AA seq 715 aa AA seqDB search
MGLSRLAALHGVATSFSPSADVTVSVPDDTVTAVLAALGVDADTPADVRRSLAAAESAAA
SRLLPPTVVAWSGEPLPAALAALPAGARLTVDPEPGTTGAPRPLRMRVLPAPAPVENAPK
TPTWWTEPPLGVHRLTVRTPDHRHITATLVVAPDRVPQPPPRTHGFLVQLYSMLSARSWG
MGDLADLADLAAWAGRTLGSGFVQVNPLHAAVPGRPTDPSPYRPSSRRFPDPVHLHIESI
PEYGHVGEPGRAALDDLRQEAAALREAVLNKGALIDRDAVWALKKQALEIVHEVPLTPGR
RAAYCDFLAAQGQALEDHALWCALAEAHGPQWRAWPAGLRDPRSPQSARARTELLDRVDF
HCRLAWLTDTQLATAQSAARESGMPVGIVHDLAVGVHPDGADTWAQQDAFARGMSVGAPP
DAFNAHGQDWGLPPWRPDALAASGYAPYRDLLRGLLAHAGALRIDHVMGLFRLWWVPEGR
PPTEGAYVAQDAEAMLAVLVLEAHRAGAVVVGEDLGTVEPGVREALARRGVLGTSVLWFE
RDWAGSGRPLAPGAWRQGCVATATTHDLPSTAARLTGEHVTLRHRLGLLTHPLERELAED
AADTAEWLAYLARLRLLPEGEGDEEAAVRAVHRFLRSTPALMSGVWLPDAVGDRRPQNLP
GTWDQYPNWRLPVADAEGHPVTLEEITASPRLHRLMAVLTDGPESRTAPPDARPS
NT seq 2148 nt NT seq  +upstreamnt  +downstreamnt
atgggcttgtcccggctcgccgcactgcacggcgtcgccacctccttctccccgtccgcg
gacgtcacggtgtccgtccccgacgacacggtcacggccgtgctcgccgcgctgggcgtc
gacgccgacacgcccgccgacgtacggagatcgctcgccgcagccgaatcggcggcggct
tcccgactgctcccgccgacggtggttgcctggtcgggggagccgctgccggccgcgctc
gccgcactgccggccggcgcgcgcctcacggtcgatcccgagccggggaccaccggcgca
ccccggccccttcgtatgcgggtcctgcccgcccccgcacccgtcgagaacgcgccgaag
acgcccacctggtggaccgaaccgcccctgggcgtccaccggctgaccgtccgcaccccg
gaccaccgccacatcaccgccacgctcgtcgtcgctccggaccgcgtaccccagccgccc
ccgcgcacgcacggattcctcgtccagctctactcgatgctctccgcccgctcctggggc
atgggcgacctcgcggacctggccgacctcgccgcatgggcggggcggaccctcggcagc
ggattcgtccaggtcaacccgctgcacgccgccgtgcccggccggcccaccgacccgtcc
ccgtaccggccctcctcgcgccgcttccccgaccccgtgcatctgcacatcgagtcgatc
cccgagtacggccacgtcggcgagcccggcagggcggccctggacgacctgcgccaggaa
gccgcggcgctgcgcgaggccgtgctgaacaagggcgcgctgatcgaccgtgacgccgtc
tgggcgctcaagaagcaggccctggagatcgtccacgaggtccccctgacccccggtcgc
cgtgccgcctactgcgacttcctggccgcgcaggggcaggccctggaggaccacgccctg
tggtgcgccctggccgaggcgcacggcccgcagtggcgcgcctggcccgcagggcttcgc
gacccccgctccccgcagagcgcccgggcccgcaccgaactgctcgacagggtcgacttc
cactgccggctcgcctggctcacggacacccagctcgccaccgcccagagcgccgcccgg
gagtccgggatgcccgtcgggatcgtccacgacctcgccgtcggcgtacaccccgacggc
gccgacacctgggcacagcaggacgccttcgcccggggcatgtccgtcggcgcgcccccc
gacgccttcaacgcccacggccaggactggggacttcccccctggcggccggacgccctc
gcggcgtccgggtacgccccctaccgcgacctcctgcggggcctcctcgcccacgccggc
gcgctgcgcatcgaccacgtcatgggcctcttccggctctggtgggtccccgaggggcgc
ccgcccaccgagggtgcctacgtcgcccaggacgccgaggcgatgctcgccgtcctcgtc
ctggaggcgcaccgggcgggtgccgtcgtcgtaggggaggacctcggcaccgtcgagccc
ggcgtgcgcgaggcgctggcccggcgcggggtgctcggcacctccgtgctctggttcgag
cgcgactgggcggggagcgggcgcccgctggcccccggggcctggcgccagggctgcgtg
gccacggcgaccacccacgacctgccctccaccgccgcgcggctgacgggtgaacacgtg
acgctccgccaccggctcgggctgctgacccaccctctggagcgggagctggccgaggac
gcggccgacaccgccgaatggctcgcctacctggcccggctccggctgctgcccgagggc
gagggggacgaggaggcggccgtccgcgcggtccaccgcttcctgcggagcaccccggcc
ctgatgtccggcgtctggctcccggacgccgtgggcgaccgccgcccgcagaacctgccc
gggacctgggaccagtaccccaactggcgcctgcccgtcgccgacgcggaaggccatccc
gtcaccctggaggagatcacggcctcaccccggctgcaccggctgatggccgtcctgacg
gacggtccggagtcccgtacggcacccccggacgcgcgcccctcgtag

DBGET integrated database retrieval system