KEGG   Streptomyces pratensis: Sfla_4418Help
Entry
Sfla_4418         CDS       T01647                                 

Definition
ABC transporter
Orthology
K10548  
putative multiple sugar transport system ATP-binding protein
Organism
sfa  Streptomyces pratensis
Pathway
ABC transporters
Module
Multiple sugar transport system
Brite
KEGG Orthology (KO) [BR:sfa00001]
 Environmental Information Processing
  Membrane transport
   02010 ABC transporters
    Sfla_4418
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(5118998..5120548)
Genome map
AA seq 516 aa AA seqDB search
MAGPVLEMRSIVKTFPGVKALSDVTLTVRQGEVHAICGENGAGKSTLMKVLSGVHPHGSY
EGDVLFESETCRFKDIRASEQHGIVIIHQELALVPYLSIAENIFLGNEHAKRGLINWNDT
LRHAGELLRRVGLDEHPETRVADIGVGKQQLVEIAKALSKKVKLLILDEPTAALNDEDSG
KLLDLILSLKEQGMTSIIISHKLNEIRRVADSVTIIRDGRSIETLDVKAEGTTEDRIISG
MVGRDLENRFPDRTPHHPEEGTAPALEIRNWTVHHPIDQQRKVVDDVSIEVRRGEIVGLA
GLMGAGRTELAMSVFGRSYGRYASGTVLKDGAEIRTKSVPEAVAHGIAYATEDRKHYGLN
LIDTINRNISLTALGKVAKRGVVDEHGERQVAEGFRKSMNIKAPTVFEPVGKLSGGNQQK
VVLSKWIFAGPEVLILDEPTRGIDVGAKYEIYTVIDQLAAQGKAVVFISSELPELLGMCD
RIYTMAAGRLTGEFSRAEASQEALMRQMTKDKEVTR
NT seq 1551 nt NT seq  +upstreamnt  +downstreamnt
atggcgggacccgtcctggaaatgcgctcgatcgtcaagacctttcccggtgtcaaagcg
ctctcggacgtcacactgaccgtccggcagggcgaggtccacgccatctgcggtgagaac
ggcgccggcaagtcgaccctgatgaaggtgctctccggcgtccatccgcacggcagctac
gaaggggacgtcctcttcgagagcgagacctgccggttcaaggacatccgggcgagcgag
cagcacggcatcgtgatcatccaccaggagctggcgctggtgccgtacctctccatcgcg
gagaacatcttcctcggcaacgagcacgccaagcgcgggctcatcaactggaacgacacc
ctcaggcacgccggtgaactgctgcgccgggtcggcctcgacgagcaccccgagacccgc
gtcgccgacatcggcgtgggcaagcagcagctggtggagatcgccaaggccctgtcgaag
aaggtgaagctgctcatcctcgacgagccgacagcggcgctcaacgacgaggacagcggc
aaactcctcgacctgatcctctcgttgaaggaacagggcatgacctcgatcatcatctcg
cacaagctgaacgagatccgccgggtggccgactcggtcacgatcatccgcgacgggcgc
tccatcgagacgctcgacgtgaaggcggaggggacgaccgaggaccggatcatcagcgga
atggtcggccgggacctggagaaccgcttcccggaccggaccccgcaccatccggaggag
ggcaccgcgcccgccctggagatccgcaactggaccgtgcaccaccccatcgaccagcag
cgcaaggtggtcgacgacgtctcgatcgaggtgcggcgcggcgagatcgtcggtctcgcc
gggctcatgggcgccggccgcaccgagctggcgatgagcgtcttcggccgctcctacggc
cgttacgcgagcggcaccgtcctgaaggacggcgccgagatccgtacgaagtccgtcccc
gaggcggtcgcgcacggcatcgcgtacgccaccgaggaccgtaagcactacggcctcaac
ctcatcgacaccatcaaccggaacatctcgctgaccgcgctgggcaaggtcgccaagcgg
ggtgtcgtcgacgagcacggggagcggcaggtcgccgagggcttccggaagtccatgaac
atcaaggctccgaccgtcttcgaaccggtgggcaagctgtccggcggcaaccagcagaag
gtcgtcctcagcaagtggatcttcgccggtcccgaggtgctgatcctggacgagcccacg
cgcggcatcgacgtgggtgccaagtacgagatctacacggtcatcgaccagctggccgcc
cagggcaaggcggtcgtcttcatatcctccgaactgccggagctgctcggcatgtgcgac
cgcatctacaccatggccgcgggacggctgacgggtgagttctcgcgggccgaggcatcg
caggaagcgctgatgcgtcagatgacgaaggacaaagaggtaacccgatga

DBGET integrated database retrieval system