KEGG   Streptomyces pratensis: Sfla_4502Help
Entry
Sfla_4502         CDS       T01647                                 

Definition
3-hydroxybutyrate dehydrogenase
Orthology
K00019  
3-hydroxybutyrate dehydrogenase [EC:1.1.1.30]
Organism
sfa  Streptomyces pratensis
Pathway
Synthesis and degradation of ketone bodies
Butanoate metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sfa00001]
 Metabolism
  Carbohydrate metabolism
   00650 Butanoate metabolism
    Sfla_4502
  Lipid metabolism
   00072 Synthesis and degradation of ketone bodies
    Sfla_4502
Enzymes [BR:sfa01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.30  3-hydroxybutyrate dehydrogenase
     Sfla_4502
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
5201908..5202684
Genome map
AA seq 258 aa AA seqDB search
MQNSRTPEHDPRTLAGRTALVTGAASGIGLACAEALAAAGARVHVVDKAGDAAESLAKRI
GGTAWVADLSVAEEVDGLPADVDIVVNNAGLQHVAPVHEFPPDRFALIHRVMVEAPFRVL
RRTLPGMYERGWGRVVNISSVHGLRASPYKSAYVSAKHALEGLSKVVALEAAAHGVTSNC
VSPGYVRTPLVEDQIADQARSHGISEQEVVGRVLLERSALKSLIEPGDVAEAVLWLCGPG
TAHITGSSLTMDGGWTAN
NT seq 777 nt NT seq  +upstreamnt  +downstreamnt
atgcagaattcccggacccccgagcacgacccccgcaccctcgccggacgcaccgccctg
gtcaccggtgccgcgagcggcatcggactggcctgcgcagaggcactcgccgccgcggga
gcccgtgtgcacgtggtggacaaggcgggcgacgccgcagagagcctggcgaaacgcatc
ggcggaacggcctgggtggccgacctctccgtggccgaggaggtggacgggctgcccgcc
gacgtggacatcgtggtcaacaacgcggggctgcagcacgtggcgcccgtgcacgagttc
ccgccggaccgcttcgccctgatccaccgcgtcatggtggaagccccgttccgcgtcttg
cgccgcacgctccccggcatgtacgaacgcggctggggccgcgtcgtcaacatctcgtcc
gtgcacgggctgcgcgcgagtccctacaagtcggcctacgtctcggccaagcacgcactg
gagggtctcagcaaggtggtcgcactcgaagcggcggcgcacggcgtgacgagcaactgc
gtcagccccggctacgtccgcacgcccctggtcgaggaccagatcgccgaccaggcccgc
agccacggcatttccgagcaggaggtggtgggccgggtcctgctggagcgcagcgccctc
aagtcgctgatcgaacccggtgacgtggccgaggccgtcctgtggctgtgcggaccgggc
acggcgcacatcacggggagctccctcacgatggacggcggctggaccgccaactga

DBGET integrated database retrieval system