KEGG   Streptomyces flavogriseus: Sfla_4502Help
Entry
Sfla_4502         CDS       T01647                                 

Definition
3-hydroxybutyrate dehydrogenase
Orthology
K00019  
3-hydroxybutyrate dehydrogenase [EC:1.1.1.30]
Organism
sfa  Streptomyces flavogriseus
Pathway
Synthesis and degradation of ketone bodies
Butanoate metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Butanoate metabolism [PATH:sfa00650]
Metabolism; Lipid metabolism; Synthesis and degradation of ketone bodies [PATH:sfa00072]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
5201908..5202684
Genome map
AA seq 258 aa AA seqDB search
MQNSRTPEHDPRTLAGRTALVTGAASGIGLACAEALAAAGARVHVVDKAGDAAESLAKRI
GGTAWVADLSVAEEVDGLPADVDIVVNNAGLQHVAPVHEFPPDRFALIHRVMVEAPFRVL
RRTLPGMYERGWGRVVNISSVHGLRASPYKSAYVSAKHALEGLSKVVALEAAAHGVTSNC
VSPGYVRTPLVEDQIADQARSHGISEQEVVGRVLLERSALKSLIEPGDVAEAVLWLCGPG
TAHITGSSLTMDGGWTAN
NT seq 777 nt NT seq  +upstreamnt  +downstreamnt
atgcagaattcccggacccccgagcacgacccccgcaccctcgccggacgcaccgccctg
gtcaccggtgccgcgagcggcatcggactggcctgcgcagaggcactcgccgccgcggga
gcccgtgtgcacgtggtggacaaggcgggcgacgccgcagagagcctggcgaaacgcatc
ggcggaacggcctgggtggccgacctctccgtggccgaggaggtggacgggctgcccgcc
gacgtggacatcgtggtcaacaacgcggggctgcagcacgtggcgcccgtgcacgagttc
ccgccggaccgcttcgccctgatccaccgcgtcatggtggaagccccgttccgcgtcttg
cgccgcacgctccccggcatgtacgaacgcggctggggccgcgtcgtcaacatctcgtcc
gtgcacgggctgcgcgcgagtccctacaagtcggcctacgtctcggccaagcacgcactg
gagggtctcagcaaggtggtcgcactcgaagcggcggcgcacggcgtgacgagcaactgc
gtcagccccggctacgtccgcacgcccctggtcgaggaccagatcgccgaccaggcccgc
agccacggcatttccgagcaggaggtggtgggccgggtcctgctggagcgcagcgccctc
aagtcgctgatcgaacccggtgacgtggccgaggccgtcctgtggctgtgcggaccgggc
acggcgcacatcacggggagctccctcacgatggacggcggctggaccgccaactga

DBGET integrated database retrieval system