KEGG   Streptomyces pratensis: Sfla_4547Help
Entry
Sfla_4547         CDS       T01647                                 

Definition
alkaline phosphatase
Orthology
K01113  
alkaline phosphatase D [EC:3.1.3.1]
Organism
sfa  Streptomyces pratensis
Pathway
Aminobenzoate degradation
Folate biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Brite
KEGG Orthology (KO) [BR:sfa00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Sfla_4547
  Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    Sfla_4547
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    Sfla_4547
Enzymes [BR:sfa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     Sfla_4547
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
5247019..5248686
Genome map
AA seq 555 aa AA seqDB search
MTPAQISRTPGQDGRSAELRDAARRLGAGVGRRRFLTVTGAAAALAFATGLPGAGTAAAA
ELDARRITEDPFTLGVASGDPLPTSVLLWTRLAPRPFEPDGGLPAERVEVRWEIARDERF
RRTVRRGTATAHPEFGHSVHVDVRGLAPDRGFYYRFRAGDWTSPTGRTRTAPAPGVRNSS
LTLAAVSCQAYHDGYFTAYRHLADEDVDVVFHLGDYLYEYAVTAVGGARNYTDRVLPGHF
NRETLTLDDYRMRYGLYKSDTDLRAAHAAHPFVVTWDDHETENNYAGDTPENSVPPEEFL
LRRAAAYRAYWENQPLRAPQRPTGPDMRLYRRLRFGRLAQFDILDTRQYRSNQAYGDGWK
VPGPESEDPARTMTGAAQERWLIDGWKASDARWNVVPQQVTFARRRDVPSDAYKLSMDSW
DGYPASRQRIMDGAEAAGIENLMVLTGDVHVGYGFDLKKDFDDPASRTVGTEIVATSITS
GKDGSEKPANWNNLTQANPHMKFYNGRRGYALVTLGTREARADFRTVSAVTTPGAPVGTA
GSFVTEAGNPGLTPA
NT seq 1668 nt NT seq  +upstreamnt  +downstreamnt
atgacacccgcacagatcagcaggacgcccggccaggacggccggtccgccgaactccgc
gatgccgcacgcaggctcggagccggagtgggccgccgccgtttcctcaccgtcaccggt
gccgccgccgcgctcgccttcgcgaccggtctgcccggcgcgggcaccgccgcggccgcc
gagctcgacgcccggaggatcacggaggacccgttcaccctcggggtggcctccggggac
cccctgccgacgtccgtactgctgtggaccagactcgcgccccgccccttcgagcccgac
ggcgggctgcccgccgagcgcgtcgaggtccgctgggagatcgcccgcgacgaacgcttc
cgccgcaccgtccggcgcgggaccgccaccgcccacccggagttcgggcacagcgtccac
gtggacgtgcgagggctcgctcccgaccggggcttctactaccgcttccgggccggcgac
tggaccagccccaccggccgcacccgcaccgcgcccgctcccggcgtacgcaacagctcc
ctgacactggccgccgtctcctgccaggcgtaccacgacggctacttcaccgcctaccgg
cacctcgccgacgaggacgtcgacgtggtcttccacctcggcgactacctctacgagtac
gccgtcacggccgtcggaggcgcccgcaactacaccgaccgcgtcctgcccggccacttc
aaccgcgagacgctcacgctggacgactaccgcatgcggtacgggctctacaagtccgac
accgacctgcgggccgcgcacgccgcgcaccccttcgtcgtcacctgggacgaccacgag
accgagaacaactacgcgggtgacaccccggagaacagcgtccccccggaggagttcctg
ctgcgcagggccgccgcctaccgggcctactgggagaaccagccgctgcgcgccccgcag
cgccccaccggccccgacatgcggctctaccggcggctgcgcttcggccggctcgcccag
ttcgacatcctcgacacccgccagtaccgcagcaaccaggcctacggcgacggctggaag
gtccccgggcccgagtccgaggacccggcgcgcaccatgacgggagccgcccaggaacgc
tggctgatcgacggctggaaggcctccgacgcccgctggaacgtcgtaccccagcaggtc
accttcgcccgccggcgcgacgtcccgtccgacgcctacaagctgtccatggactcctgg
gacggctaccccgcctcccggcagcggatcatggacggcgccgaggccgccgggatcgag
aacctgatggtgctcaccggtgacgtgcacgtcggctacggcttcgacctcaagaaggac
ttcgacgacccggcctcccggaccgtcggcacggagatcgtggccacctcgatcaccagc
ggcaaggacggctccgagaagccggccaactggaacaacctgacccaggccaacccgcac
atgaagttctacaacgggcgccgcggctacgcactcgtcaccctcggcacgcgcgaggca
cgcgccgacttccgcacggtgtcggccgtcaccacgcccggcgcgccggtcggcacggcg
ggctccttcgtgaccgaggccggcaacccggggctcacccccgcctga

DBGET integrated database retrieval system