KEGG   Streptomyces pratensis: Sfla_4645Help
Entry
Sfla_4645         CDS       T01647                                 

Definition
(GenBank) 2-oxoglutarate dehydrogenase, E2 component, dihydrolipoamide succinyltransferase
  KO
K00658  2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
sfa  Streptomyces pratensis
Pathway
sfa00020  Citrate cycle (TCA cycle)
sfa00310  Lysine degradation
sfa01100  Metabolic pathways
sfa01110  Biosynthesis of secondary metabolites
sfa01120  Microbial metabolism in diverse environments
sfa01130  Biosynthesis of antibiotics
sfa01200  Carbon metabolism
Module
sfa_M00009  Citrate cycle (TCA cycle, Krebs cycle)
sfa_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:sfa00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Sfla_4645
  Amino acid metabolism
   00310 Lysine degradation
    Sfla_4645
Enzymes [BR:sfa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     Sfla_4645
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding GCV_H Biotin_lipoyl_2 HlyD_3 HlyD_D23
Motif
Other DBs
NCBI-ProteinID: ADW06046
UniProt: E8WGB3
Position
complement(5356671..5358509)
Genome map
AA seq 612 aa AA seqDB search
MSVSVTLPALGESVTEGTVTRWLKAEGERVEADEPLLEVSTDKVDTEIPAPASGVLSAIK
VAEDETVEVGAELAVIDDGSGAPAAAEAPAAEAPAQEAPAAAPAQEAPAQEAPAPAAEAP
AQEAPAAAPAGGASGTDVTLPALGESVTEGTVTRWLKEVGEEVTEDEPLLEVSTDKVDTE
IPAPVSGVLLEIVVAEDETAEVGAKLAVIGAPGAAPAAAPAEAAPAPAAAPAPAAPAAPA
APAPAPAAPAAPAPAPAQATPAAPAPAAPAPAPAAQAPAAPAAQAPAAPAAQAPAAPTAP
SSGDEGAYVTPLVRKLAAENGVDLGAVKGTGVGGRIRKQDVVAAAEAAKAAAPAPAAAAA
PAAKAAPKLEASPLRGQTVKMTRMRKVIGDNMMKALHSQAQLTSVLEVDITKLMKLRNQA
KESFAAREGVKLSPMPFFVKAAAQALKAHPVVNARINEDEGTITYFDSENIGIAVDAEKG
LMTPVIKGAGDLNIAGIAKKTAELAGKARGGGLTPDDMSGATFTVSNTGSRGALFDTVIV
PPNQAAILGIGATVKRPAVIETAEGTVIGVRDMTYLSLSYDHRLVDGADAARYLTTVKAI
LEAGEFEVELGL
NT seq 1839 nt NT seq  +upstreamnt  +downstreamnt
atgtcggtttccgtaacccttccggcgctcggcgagagcgtcaccgagggcactgtcacc
cgttggctgaaggccgagggcgagcgcgtcgaggccgacgagccgctgctcgaggtctcg
accgacaaggtcgacaccgagatccccgcgccggcctccggcgtgctctcggccatcaag
gtcgccgaggacgagaccgtcgaggtcggcgccgagctggccgtcatcgacgacggctcg
ggagcgcctgccgccgccgaggcgcccgccgccgaggctccggcacaggaggcgcccgcc
gccgccccggcacaggaggccccggcccaggaggctccggcccccgccgccgaggctccc
gcccaggaggcacccgcggccgcgccggccggtggcgcctccggcaccgacgtcaccctc
cccgcgctcggcgagagcgtcaccgagggcaccgtcacccgctggctgaaggaggtcggc
gaggaggtcacggaggacgagcccctgctcgaggtctccacggacaaggtcgacaccgag
atccccgccccggtctccggcgtgctgctggagatcgtcgtcgccgaggacgagaccgcc
gaggtgggcgccaagctcgccgtcatcggcgccccgggtgccgcgcccgccgccgctccg
gcggaggccgccccggcacccgccgcggctccggccccggcggctcccgcagcaccggcc
gctccggctccggctccggcggcccctgccgctccggcaccggctccggcacaggccact
ccggccgctccggcaccggctgcgcccgccccggctccggccgcgcaggccccggccgct
ccggccgcgcaggccccggccgctccggccgcgcaggccccggccgccccgaccgcgccc
tcctcgggtgacgagggcgcgtacgtcacgccgctggtgcgcaagctcgccgccgagaac
ggcgtcgacctgggcgcggtcaagggcaccggcgtcggtggccgtatccgcaagcaggac
gtggtggccgccgcggaggccgccaaggccgccgctccggctccggccgccgccgccgct
cccgcggccaaggccgcgccgaagctcgaggcgtccccgctgcgcggtcagacggtcaag
atgacccgcatgcgcaaggtcatcggcgacaacatgatgaaggcgctgcactcgcaggcc
cagctgacctcggtcctcgaggtcgacatcaccaagctgatgaagctgcgcaaccaggcg
aaggagtccttcgccgcccgtgagggcgtcaagctgtccccgatgccgttcttcgtgaag
gcggcggcccaggcgctgaaggcccacccggtcgtcaacgcccggatcaacgaggacgag
ggcaccatcacgtacttcgactcggagaacatcggcatcgccgtggacgccgagaagggt
ctgatgaccccggtcatcaagggtgcgggcgacctgaacatcgccggtatcgcgaagaag
accgccgagctggccggcaaggcgcgcggtggcggcctcaccccggacgacatgtccggc
gcgaccttcaccgtcagcaacaccggttcgcgcggtgcgctgttcgacacggtcatcgtg
ccgccgaaccaggcggccatcctgggcatcggtgccacggtcaagcgtccggcggtcatc
gagaccgccgagggcaccgtcatcggcgtccgcgacatgacctacctctcgctctcctac
gaccaccgtctggtggacggcgcggacgccgcccgctacctgaccacggtcaaggcgatc
ctcgaggcgggcgagttcgaggtcgagctcggcctctga

DBGET integrated database retrieval system