KEGG   Streptomyces pratensis: Sfla_4790Help
Entry
Sfla_4790         CDS       T01647                                 

Definition
(GenBank) tryptophan synthase, beta subunit
  KO
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
sfa  Streptomyces pratensis
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:sfa00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Sfla_4790
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Sfla_4790
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Sfla_4790
Enzymes [BR:sfa01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Sfla_4790
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
5518002..5519282
Genome map
AA seq 426 aa AA seqDB search
MSSDFFIPDPEGLIPSAEGYFGAFGGKFIPEALVAAVDEVAVEYDKAKADPAFAAELNAL
MVDYTGRPSALTEVTRFAEHAGGARVFLKREDLNHTGSHKINNVLGQALLTKRMGKTRII
AETGAGQHGVATATACALFGLECTIYMGEIDTERQALNVARMRMLGAEVVAVKSGSRTLK
DAINEAFRDWVANVDRTHYLFGTVAGPHPFPAMVRDFHRVIGVEARRQILERAGRLPDAA
VACVGGGSNAIGLFHAFIPDADVRLIGCEPAGHGVETGEHAATLTAGEPGILHGSRSYVL
QDEEGQITEPYSISAGLDYPGIGPEHAYLKDVGRGEYRAVTDDAAMQALRLLSRTEGIIP
AIESAHALAGALEVGRELGEDGLILINLSGRGDKDMDTAARYFGLYDGADAVVEADVADG
EEEVTK
NT seq 1281 nt NT seq  +upstreamnt  +downstreamnt
atgtcgtccgacttcttcatcccggaccccgagggtctgatccccagcgccgaggggtat
ttcggcgcgttcggtggcaagttcatcccggaggcactggtcgccgccgtggacgaggtc
gccgtcgagtacgacaaggccaaggcggacccggccttcgccgccgagctcaacgcgctc
atggtcgactacaccggccggcccagcgcgctgaccgaggtcacccgcttcgccgagcac
gccgggggcgcccgcgtcttcctcaagcgcgaggacctcaaccacaccggctcgcacaag
atcaacaacgtgctcggccaggccctgctgaccaagcggatgggcaagacccgcatcatc
gcggagaccggagcgggccagcacggtgtcgccaccgcgaccgcctgcgccctcttcggg
ctcgaatgcaccatctacatgggtgagatcgacaccgagcggcaggcgctgaacgtggcg
cggatgcggatgctcggcgccgaggtcgtcgccgtgaagtccggctcccggaccctcaag
gacgccatcaacgaggcgttccgcgactgggtcgccaacgtcgaccgcacccactacctc
ttcggcacggtcgccggcccgcaccccttccccgcgatggtccgcgacttccaccgggtg
atcggcgtcgaggcccgccgccagatcctggagcgcgccggccggctgccggacgccgcc
gtcgcctgcgtgggcggcgggtccaacgccatcggcctcttccacgccttcatcccggac
gcggacgtccggctgatcggctgcgaacccgccggacacggcgtggagaccggtgaacac
gcggcgaccctgaccgcgggcgagcccgggatcctgcacggctcacgctcctacgtcctc
caggacgaggagggccagatcaccgagccgtattcgatctccgccggactcgactacccg
ggcatcggcccggagcacgcctacctcaaggacgtcggccggggcgagtaccgcgcggtc
accgacgacgccgcgatgcaggcgctgcgcctcctctctcgcaccgaggggatcatcccg
gccatcgagagcgcgcacgcgctggccggagccctggaggtcggccgcgaactgggcgag
gacgggctgatcctgatcaacctgtccggccgcggcgacaaggacatggacacggccgcc
cggtacttcgggctgtacgacggcgccgacgcggtcgtcgaggccgacgtggccgacgga
gaggaagaggtcaccaagtga

DBGET integrated database retrieval system