KEGG   Streptomyces pratensis: Sfla_4791Help
Entry
Sfla_4791         CDS       T01647                                 

Definition
(GenBank) tryptophan synthase, alpha subunit (EC:4.2.1.20)
  KO
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
sfa  Streptomyces pratensis
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:sfa00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Sfla_4791
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Sfla_4791
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Sfla_4791
Enzymes [BR:sfa01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Sfla_4791
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
5519279..5520091
Genome map
AA seq 270 aa AA seqDB search
MSGNRELLEATLAKAASEDRAALIAYLPGGFPTVDGGIAAVKAAVAGGADVVEVGLPHSD
PVLDGPVIQTADDIALRGGVKIADIMRTVREAHVATGAPILVMTYWNPIDRYGVERFTAE
LAEAGGAGCILPDLPVQESALWREHAEKHGLATVFVVAPSSKDARLATITAAGSGFVYVA
SLMGVTGTRESVGQQAQDLVRRTRATTDLPVCVGIGVSTAEHARQVAGFADGVIVGSAFV
KRMLDAPDEAAGLAAVRALAGELAEGVRKR
NT seq 813 nt NT seq  +upstreamnt  +downstreamnt
gtgagcggcaaccgagagcttctcgaagcgacgctcgccaaggcggcgtccgaggaccgg
gcggcactcatcgcctacctgcccggcggcttcccgaccgtcgacggcggcatcgcggcg
gtcaaggcggccgtcgcgggcggcgccgacgtcgtcgaggtggggctcccgcacagcgac
ccggtgctcgacgggccggtcatccagaccgccgacgacatcgcgctgcgcggcggggtc
aagatcgccgacatcatgcgcacggtccgcgaggcgcacgtggcgacgggcgcgccgatc
ctcgtcatgacgtactggaacccgatcgaccggtacggcgtggagcgcttcaccgccgag
ctcgccgaggccggcggcgccgggtgcatcctgccggacctgcccgtccaggagtcggcc
ctgtggagggagcacgcggagaagcacggtctcgccaccgtcttcgtcgtcgccccgagc
agcaaggacgcccgcctcgccaccatcacggccgccgggtccggcttcgtgtacgtcgcc
tccctgatgggcgtcaccggcacccgcgaatcggtcggccagcaggcgcaggacctggtg
cggcgcacccgggccaccaccgacctgcccgtctgcgtcggcatcggtgtctccaccgcc
gagcacgcccggcaggtcgcgggcttcgccgacggggtgatcgtcggctcggccttcgtg
aagcggatgctggacgcccccgacgaggcggccgggctcgccgccgtccgcgcgctggcg
ggcgaactggccgaaggcgttcgaaagcgctga

DBGET integrated database retrieval system