KEGG   Streptomyces pratensis: Sfla_4791Help
Entry
Sfla_4791         CDS       T01647                                 

Definition
tryptophan synthase subunit alpha
Orthology
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
sfa  Streptomyces pratensis
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:sfa00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Sfla_4791
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Sfla_4791
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Sfla_4791
Enzymes [BR:sfa01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Sfla_4791
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
5519279..5520091
Genome map
AA seq 270 aa AA seqDB search
MSGNRELLEATLAKAASEDRAALIAYLPGGFPTVDGGIAAVKAAVAGGADVVEVGLPHSD
PVLDGPVIQTADDIALRGGVKIADIMRTVREAHVATGAPILVMTYWNPIDRYGVERFTAE
LAEAGGAGCILPDLPVQESALWREHAEKHGLATVFVVAPSSKDARLATITAAGSGFVYVA
SLMGVTGTRESVGQQAQDLVRRTRATTDLPVCVGIGVSTAEHARQVAGFADGVIVGSAFV
KRMLDAPDEAAGLAAVRALAGELAEGVRKR
NT seq 813 nt NT seq  +upstreamnt  +downstreamnt
gtgagcggcaaccgagagcttctcgaagcgacgctcgccaaggcggcgtccgaggaccgg
gcggcactcatcgcctacctgcccggcggcttcccgaccgtcgacggcggcatcgcggcg
gtcaaggcggccgtcgcgggcggcgccgacgtcgtcgaggtggggctcccgcacagcgac
ccggtgctcgacgggccggtcatccagaccgccgacgacatcgcgctgcgcggcggggtc
aagatcgccgacatcatgcgcacggtccgcgaggcgcacgtggcgacgggcgcgccgatc
ctcgtcatgacgtactggaacccgatcgaccggtacggcgtggagcgcttcaccgccgag
ctcgccgaggccggcggcgccgggtgcatcctgccggacctgcccgtccaggagtcggcc
ctgtggagggagcacgcggagaagcacggtctcgccaccgtcttcgtcgtcgccccgagc
agcaaggacgcccgcctcgccaccatcacggccgccgggtccggcttcgtgtacgtcgcc
tccctgatgggcgtcaccggcacccgcgaatcggtcggccagcaggcgcaggacctggtg
cggcgcacccgggccaccaccgacctgcccgtctgcgtcggcatcggtgtctccaccgcc
gagcacgcccggcaggtcgcgggcttcgccgacggggtgatcgtcggctcggccttcgtg
aagcggatgctggacgcccccgacgaggcggccgggctcgccgccgtccgcgcgctggcg
ggcgaactggccgaaggcgttcgaaagcgctga

DBGET integrated database retrieval system