KEGG   Streptomyces pratensis: Sfla_4796Help
Entry
Sfla_4796         CDS       T01647                                 

Definition
ribokinase
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
sfa  Streptomyces pratensis
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:sfa00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    Sfla_4796
Enzymes [BR:sfa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     Sfla_4796
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(5524200..5525084)
Genome map
AA seq 294 aa AA seqDB search
MTAIAVLGSTNMDLVAYVARAPGRGETVTGREFRTVPGGKGANQAVAAARAGGEVVMIGA
VGTDEYGSALRTHLEHAGVDTDLLHTVAGPSGTAHIVVDDEGANSIVVIPGANGSVTALG
PGERAAVSAAGLLLLQLELPLTAVTEAARTARDRGVRTILTPSPVRTLPSALLAAVDLLI
PDEHEATALTGCAEPHAAAQILLRQVPAVVITLGRKGCLYAARGAEPVLFPAPEVTAVDT
TGAGDTFVGTLAVALGEGRPVPEAVAWASSAAALCVQRQGASTSMPHRSEIDAA
NT seq 885 nt NT seq  +upstreamnt  +downstreamnt
atgacagcgatcgcggtgctcggcagcaccaacatggacctggtcgcctacgtcgcccgg
gcacccgggcgcggggagaccgtcaccggacgggagttccggaccgtccccggaggcaag
ggggccaaccaggccgtcgccgcggcccgcgcgggaggcgaggtggtgatgatcggcgcg
gtcgggaccgacgagtacggctcggccctccgcacgcatctggagcacgccggagtggac
accgacctgctccacaccgtcgcggggcccagcggcaccgcgcacatcgtcgtcgacgac
gagggggccaactccatcgtggtgatcccgggcgccaacggcagcgtgaccgcgctcggc
cccggcgagagggcggccgtctcggcggcgggcctgctgctcctgcagctggaacttccg
ctgaccgccgtgaccgaggcggcccggaccgcgagggaccgcggcgtacggacgatcctc
accccctcccccgtgcggacgctgccgtccgcgctgctggccgccgtcgacctgctgatc
cccgacgagcacgaggccaccgcgctcaccggctgcgcggaaccgcacgccgcggcgcag
atcctgctccgccaggtacccgcggtcgtgatcacactcggccgcaagggctgcctctac
gcggcccggggcgccgaaccggtcctcttcccggcccccgaggtcaccgccgtcgacacg
accggcgccggcgacaccttcgtcggcacgctcgccgtggcgctcggcgagggccggccg
gtgcccgaggcggtggcctgggcgtcgtccgccgccgcgctctgcgtacagaggcagggt
gcctcgacgtccatgccccaccgcagcgagatcgatgccgcatga

  All links  
No link information was found.   
DBGET integrated database retrieval system