KEGG   Streptomyces pratensis: Sfla_4932Help
Entry
Sfla_4932         CDS       T01647                                 

Definition
pectinesterase
Orthology
K01051  
pectinesterase [EC:3.1.1.11]
Organism
sfa  Streptomyces pratensis
Pathway
Pentose and glucuronate interconversions
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sfa00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Sfla_4932
   00500 Starch and sucrose metabolism
    Sfla_4932
Enzymes [BR:sfa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.11  pectinesterase
     Sfla_4932
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
5682762..5683865
Genome map
AA seq 367 aa AA seqDB search
MPSRRSALTLLAGAGAALALGTPAAGARPAHTRPFGRYGSPSRRLDALTLYVDPLGRGDH
TDVASAVEAASGTGHTLVLAPGTYRGPVLVTAARAELTVIGASGDPRDTVIVHDNAAGTP
RPDGSGPYGTSGSATVTVQAAGFTARDVTFANDWLRSDNPEYTGTQAVAIKVQGDRSAFH
GCRFLGHQDTLYADSLALTAFARQYYRDCYVEGDVDFVFGRATAVFDRCHFRTLDRTDLA
AAPYGFVFAPSTAGANPRGYLVLRSRVTSTAPDAYYKLARPWVPSSDPTAHPMLTVRDSH
LGAGIDAVTPYGTMSAGFPWQDQRFAEYRNTGPGARVTVPGNRPQLTASEARAHTPADWL
GDWRPRA
NT seq 1104 nt NT seq  +upstreamnt  +downstreamnt
atgcccagcagacgcagcgcgctgaccctgctcgcgggggcgggcgccgccctcgccctc
ggcacccccgccgccggggcgcggcccgcccacacccgccccttcggccgctacgggtca
ccctcccgccggctcgacgccctgacgctgtacgtcgacccgctcggccggggcgaccac
accgacgtggcgtccgccgtcgaagccgcgtccggcaccggtcacaccctggtcctcgcc
cccggcacctaccgcggcccggtcctcgtcaccgccgcccgggcggagctcaccgtcatc
ggcgcgagcggcgacccccgggacaccgtcatcgtccacgacaacgccgccggaacaccc
aggcccgacggctccggcccctacggcaccagcggatcggccacggtcaccgtccaggcc
gccggcttcaccgcccgcgacgtgaccttcgccaacgactggctgcgctccgacaacccg
gagtacaccggcacccaggccgtcgcgatcaaggtgcagggcgaccgctccgcgttccac
ggctgccgcttcctcggccaccaggacaccctgtacgccgactccctcgcactcaccgcc
ttcgcgcgccagtactaccgcgactgctacgtggagggcgacgtcgacttcgtcttcggc
cgggccaccgccgtcttcgaccgctgccacttccgcaccctggaccgcaccgacctcgcc
gccgccccgtacggcttcgtcttcgcgcccagcaccgccggagccaacccgcgcggctac
ctggtgctgcgctcccgggtcaccagcaccgcccccgacgcgtactacaaactggcccgc
ccctgggtgccctcctccgacccgaccgcccacccgatgctgaccgtccgggacagccac
ctcggcgccggcatcgacgcggtcacgccgtacggcaccatgtccgcgggcttcccctgg
caggaccagcgcttcgccgagtaccgcaacaccggtcccggcgcgcgcgtcaccgtcccc
ggcaaccgtccgcagctgaccgcgtccgaggcacgcgcgcacaccccggccgactggctg
ggcgactggcgcccccgcgcgtga

DBGET integrated database retrieval system