KEGG   Streptomyces pratensis: Sfla_4966Help
Entry
Sfla_4966         CDS       T01647                                 

Definition
cobaltochelatase subunit
Orthology
K03404  
magnesium chelatase subunit D [EC:6.6.1.1]
Organism
sfa  Streptomyces pratensis
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:sfa00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Sfla_4966
Enzymes [BR:sfa01000]
 6. Ligases
  6.6  Forming nitrogen-D-metal bonds
   6.6.1  Forming coordination complexes
    6.6.1.1  magnesium chelatase
     Sfla_4966
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(5721451..5723493)
Genome map
AA seq 680 aa AA seqDB search
MSTPYPFTALVGQDDLRLGLLLNAVSPAVGGVLVRGEKGTAKSTAVRALAALMPEVAVVA
GCRFSCDPGAPDPACPDGPHEAGTGVSRAARTVELPVGASEDRLVGALDIERALSEGVKA
FEPGLLADAHRGILYVDEVNLLHDHLVDLLLDAAAMGASYVEREGVSVRHAARFLLVGTM
NPEEGELRPQLLDRFGLTVEVAASRETDLRVEVVRRRLAYDDDPAGFAARWADEEAALRE
RIVSARALLPRVVLGDGVLRQIAATCAAFEVDGMRADIVMARTATALAAWAGREEVVSDD
VRQAALLALPHRRRRNPFDAPGLDEDRLDEALQDAADEQGDDDPDPDGPGGGVPPQGGGP
ESDGGGSDAGGSDDGGTDDGGADAPGREDTGSGDAPAPGGGGEQQPVRAGEPFRTKVLSV
PGLGEGAAGRRSRARTEHGRTTGSRRPEGALTKLHLAATVQAAAPHQRARGRSGRGLVVR
RDDLRQATREGREGNLVLFVVDASGSMAARQRMSAVKGAVMSLLLDAYQRRDKVGLVTFR
GKDAEVALPPTSSVDAAAARLESLPTGGRTPLAAGLLKAHDVLRVERLRDPSRRPLLVVV
TDGRATGGVDPVALAGRAGRLHASEGTASVVVDCESGFVRLGLAAQLARDLGGSAVTLDE
LRADSIAGLVKDITAAGRAA
NT seq 2043 nt NT seq  +upstreamnt  +downstreamnt
gtgagtacgccgtatcccttcaccgccctcgtcgggcaggacgatctgcggctcgggctg
ctgctcaacgccgtcagtcccgccgtgggcggggtcctggtccggggcgagaagggcacc
gcgaagtccaccgcggtgcgggcgctggccgccctcatgcccgaggtcgcggtcgtggcg
gggtgccgtttctcgtgcgacccgggggcgcccgacccggcgtgtcccgacggtccgcac
gaggcggggacgggcgtgtcgcgtgcggcgcggaccgtggagctgccggtcggcgcgtcg
gaggaccggctggtgggtgcgctcgacatcgagcgggccctctcggagggggtgaaggcc
ttcgagccggggctcctcgccgacgcccatcgcgggatcctgtacgtcgacgaggtcaat
ctgctccacgaccacctggtggacctgctgctcgacgcggcggccatgggcgcctcctac
gtggagcgggagggtgtgtcggtccgtcacgccgcccgtttcctgctggtcgggacgatg
aacccggaggagggcgagctccggccgcagctgctggaccgcttcgggctgaccgtcgag
gtggccgcctcgcgtgagacggacctgcgcgtggaggtcgtgcggcggcggctcgcgtac
gacgacgacccggcggggttcgcggcacggtgggcggacgaggaggcggcgctgcgggaa
cgcatcgtctccgcgcgcgccctgctcccccgtgtggtgctcggcgacggcgtgttgcgg
cagatcgcggcgacctgcgcggcgttcgaggtcgacgggatgcgcgccgacatcgtcatg
gcccgcaccgcgacggcgctggccgcgtgggcgggacgcgaggaggtcgtctccgacgac
gtgcggcaggccgcgctgctggcactcccccaccggcgccggcgcaatccgttcgacgcg
cccgggctggacgaggacaggctggacgaggctctgcaggacgccgcggacgagcagggc
gacgacgatcccgaccccgacgggcccggcggcggggtgcccccgcagggcggcgggccc
gagagcgacggcggcggctcggacgcgggcggctccgacgacggaggtacggacgacggg
ggcgccgacgcgccgggccgggaggacaccgggagcggggacgcgcccgcgccgggcggc
ggcggtgagcagcaacccgtgcgggccggtgagccgttccggacgaaggtgctcagcgtg
ccgggtctgggcgagggcgcggcggggcggcgttccagggcgcgtaccgagcacggccgt
accaccggttcgaggcggcccgagggcgcgctgacgaagctgcacctggcggcgaccgtg
caggcggcggcgccgcaccagcgggcacgcgggaggtcgggccggggtctcgtcgtacgg
cgtgacgatctgcggcaggcgacgcgtgaggggcgcgagggcaatctcgtgctgttcgtc
gtggacgcgtccgggtcgatggcggccaggcagcggatgagcgcggtgaagggtgcggtg
atgtcgctgctgctggacgcctaccagcgcagggacaaggtcggtctggtcaccttccgg
gggaaggacgccgaggtggccctgcccccgacctcgtcggtggacgcggcggccgcccgg
ctggagtcgctcccgacgggcgggcgcaccccgctggccgccggactgctgaaggcgcac
gacgtgctgcgcgtggagcggctgcgtgatccgtcgcggcggccgctgctcgtcgtggtg
acggacgggcgggcgacggggggcgtcgatccggtcgcgctggcggggcgggccgggcgg
ctgcacgcctccgagggcaccgcgtcggtcgtcgtggactgcgagtcggggttcgtacgc
ctcggtctcgccgcacagctcgcccgggatctgggaggcagcgcggtcacgctcgacgag
ctgcgggccgactcgatcgccggactggtcaaggacatcactgctgccgggagggccgct
taa

DBGET integrated database retrieval system