KEGG   Streptomyces flavogriseus: Sfla_5176Help
Entry
Sfla_5176         CDS       T01647                                 

Definition
glycerol kinase
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
sfa  Streptomyces flavogriseus
Pathway
Glycerolipid metabolism
Metabolic pathways
Class
Metabolism; Lipid metabolism; Glycerolipid metabolism [PATH:sfa00561]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(5949863..5951392)
Genome map
AA seq 509 aa AA seqDB search
MTDAHTTGPFIAAIDQGTTSSRCIVFDKDGRIVSVDQKEHEQIFPKPGWVEHDAAEIWEN
VQEVVAGAIVKAGITSADVKAIGITNQRETTLLWDKNTGEPVHNALVWQDTRTDALCKEL
GRNVGQDRFRRETGLPLASYFAGPKVRWLLDNVEGLRERAERGDILFGTMDSWVIWNLTG
GTDGGVHVTDVTNASRTLLMNLHTMQWDDKIVQSLEIPPSVLPEIRSSAEVYGNAKGGVL
DGVPVASALGDQQAALFGQTCFAQGEAKSTYGTGTFMLMNTGHTPVNSYNGLLTTVGYRI
GDQKPVYALEGSIAVTGSLVQWMRDQMGLIKSAAEIETLASSVEDNGGAYFVPAFSGLFA
PYWRPDARGVIAGLTRYVTKAHIARAVLEATAWQTREISDAMTKDSGVELTALKVDGGMT
SNNLLMQTLSDFLDAPVVRPMVAETTCLGAAYAAGLAVGFWPDTDALRANWRRAAEWTPR
MAADTRDREYKSWLKAVERTMGWIEDEES
NT seq 1530 nt NT seq  +upstreamnt  +downstreamnt
gtgaccgacgcacacaccaccggcccgttcatcgcggccatcgaccagggcaccacgtcc
agccgctgcatcgtcttcgacaaggacggccggatcgtctccgtcgaccagaaggagcac
gagcagatcttccccaagcccggctgggtcgagcacgacgcggccgagatctgggagaac
gtccaggaggtcgtcgccggggccatcgtcaaggccggcatcacctccgccgacgtcaag
gcgatcggcatcaccaaccagcgtgagaccacgctgctgtgggacaagaacaccggtgag
cccgtccacaacgccctcgtctggcaggacacccgcaccgacgcgctctgcaaggagctc
ggccgcaacgtcggccaggaccgcttccgccgcgagaccggcctgccgctcgcgtcgtac
ttcgccggccccaaggtccgctggctgctcgacaacgtcgaagggctgcgcgagcgcgcc
gagcggggcgacatcctcttcggcaccatggactcctgggtcatctggaacctgaccggc
ggcaccgacggcggtgtccacgtcaccgacgtcaccaacgcctcgcgcaccctcctgatg
aacctgcacacgatgcagtgggacgacaagatcgtccagtccctggagatcccgccctcc
gtcctgcccgagatccggtcctccgccgaggtctacggcaacgccaagggcggcgtcctc
gacggcgttccggtggcctccgcgctcggcgaccagcaggccgcgctgttcggccagacc
tgtttcgcgcagggcgaggccaagtccacgtacggcaccggaaccttcatgctcatgaac
accggccacaccccggtgaactcgtacaacgggctgctgacgaccgtcggataccggatc
ggcgaccagaagccggtctacgccctcgaggggtccatcgccgtcaccggttcgctggtc
cagtggatgcgcgaccagatgggcctgatcaagtccgcggccgagatcgagacgctcgcc
tcctccgtcgaggacaacggcggcgcgtacttcgtgcccgcgttctccggcctgttcgcc
ccgtactggcgtcccgacgcccgcggtgtgatcgccggactcacccggtacgtcaccaag
gcgcacatcgcccgtgccgtgctcgaggccaccgcatggcagacccgcgagatcagcgac
gccatgaccaaggactccggcgtcgaactgaccgcgctcaaggtcgacggcggcatgacc
tccaacaacctgctgatgcagacgctctccgacttcctggacgcgcccgtggtgcgcccc
atggtcgccgagaccacctgcctcggcgccgcctacgccgccggtctcgccgtcggcttc
tggccggacaccgacgcgctgcgcgccaactggcgccgcgccgccgagtggacaccccgc
atggccgcggacacccgcgaccgcgagtacaagagctggctcaaggccgtcgaacggacc
atgggctggatcgaggacgaagagagctga

DBGET integrated database retrieval system