KEGG   Streptomyces pratensis: Sfla_5322Help
Entry
Sfla_5322         CDS       T01647                                 

Definition
Cholesterol oxidase
Orthology
K03333  
cholesterol oxidase [EC:1.1.3.6]
Organism
sfa  Streptomyces pratensis
Brite
KEGG Orthology (KO) [BR:sfa00001]
 Metabolism
  Xenobiotics biodegradation and metabolism
   00984 Steroid degradation
    Sfla_5322
Enzymes [BR:sfa01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.3  With oxygen as acceptor
    1.1.3.6  cholesterol oxidase
     Sfla_5322
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(6104127..6105683)
Genome map
AA seq 518 aa AA seqDB search
MSGRKSLSRRRFLTGVAAGTALGALPLRSAVASAAEPVEILIIGSGYAGSVAALRFAQAG
LHSVVLERGRRWPVTAQGGTFATPAAPDGRASWLNSWSPFVPQQLDVYPGVLEAFRADGV
IALAGAGVGGGSLVNNAVMLKPSEAAFNRAFGTDIDFDEMSERWYARARSLIGPAPMPDD
VYASSHYTAARSFTAETAAAGLAPFRADMAVDWQAVREEQAGTREASLIIARSIWGANSG
AKRSVDRTVLAAAEATGRVSVETLTRVVDVVPSGGRYVVRCERIDDTGAVVARPDYSAKR
VFFAAGSLGTSRLLVAARGRGSLPALRASVGKGWGTNSDRQTVRVGMPWNNSTQGGPSGI
VAQDLDNPYEPVTMINFPWPVPPADGTGALGALAMTTCAAEGFFSYDAATDGVSLTWPAT
GASAVRATQAVTATVNRINAANPGTSTLRVNADTTSHTLGGAVLGKACRLDGRLYGYDNL
HVIDSSLIPGTMATVPPALTVTALADRCVHKALDRMLN
NT seq 1557 nt NT seq  +upstreamnt  +downstreamnt
atgtcaggcagaaagtcgctctcccgtcggcggttcctcaccggcgtcgcggcaggtacg
gcgctcggggcgctgccgctgcggtccgccgtggcgtccgccgcggagcccgtggagatc
ctcatcatcggcagtgggtacgcgggcagcgtcgccgccctccggttcgcccaggcgggc
ctgcactcggtggtcctcgaacgaggcaggcgctggccggtcacggcgcagggcggtacg
ttcgccacccccgcggcgcctgacggccgggcgtcctggctcaactcctggagtccgttc
gtcccccagcagctcgacgtctacccgggtgtgctcgaggccttccgcgccgacggcgtc
atcgctctcgccggcgcgggtgtcggcggtggctccctggtcaacaacgcggtgatgctc
aagccgtccgaggcggcgttcaaccgggcgttcggcaccgacatcgacttcgacgagatg
agcgagcgctggtacgcgcgggcccgctccctgatcggtccggccccgatgccggacgac
gtctacgcctcgtcgcactacacggccgcccgttccttcaccgccgagaccgcggcggcg
ggcctggccccgttccgggcggacatggccgtcgactggcaggcggtgcgggaggagcag
gcgggcacccgtgaggcgtcgctgatcatcgcccgttccatctggggtgccaacagcggg
gccaagcgcagtgtcgaccggaccgtcctggccgccgccgaggcgaccggccgggtgtcg
gtggagacactgacgcgggtggtggacgtggtgccctcgggcggccgctacgtggtgcgg
tgcgaacgcatcgacgacacgggggccgtggtggcccggcccgactacagcgcgaagcgc
gtgttcttcgccgccggttcactggggaccagccggctgctggtggccgcgcggggacgc
ggcagcctgcccgcgctccgcgcctccgtcggcaagggctggggcaccaacagcgaccgg
cagacggtgcgggtggggatgccctggaacaactccacgcagggaggaccgtccggcatc
gtcgcccaggacctcgacaacccgtacgaaccggtgacgatgatcaacttcccgtggccg
gtgccgcccgcggacgggaccggagcgctcggcgccctggccatgaccacgtgcgccgca
gaggggttcttcagctacgacgcggcgaccgacggggtctccctgacctggccggccacg
ggagcctcggccgtacgcgccacccaggcggtgacggccaccgtgaaccgcatcaacgcc
gccaaccccggtacctcgaccctgcgcgtgaacgccgacaccacgtcgcacacgctcggt
ggagcggtcctcggcaaggcgtgcaggctggacggccggctgtacgggtacgacaacctg
cacgtcatcgacagctcgctgatacccggcacgatggcgacggttccccccgccctgacc
gtcaccgctctcgccgaccgctgcgtgcacaaggcgctggaccgcatgctgaactga

DBGET integrated database retrieval system