KEGG   Streptomyces pratensis: Sfla_5345Help
Entry
Sfla_5345         CDS       T01647                                 

Definition
Holliday junction DNA helicase RuvA
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
sfa  Streptomyces pratensis
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:sfa00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    Sfla_5345
Enzymes [BR:sfa01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     Sfla_5345
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
6130152..6130778
Genome map
AA seq 208 aa AA seqDB search
MIAFVSGPVAALAPTTAVIEVGGIGMAVQCTPGTLAGLRIGTDARLATSLVVREDSLTLY
GFADDDERQVFELLQTASGVGPRLAQAMLATHSPDALRTAVATGDEKALTAVSGIGKKGA
QKLLLELKDRLGDPVGARIGQQGVGTPVSSSWRDQLQAALIGLGYATREADEAVTAVTPQ
AEAAIAGGGQAPVPQLLRAALQTLNRAR
NT seq 627 nt NT seq  +upstreamnt  +downstreamnt
atgatcgccttcgtctccggcccggtggccgccctcgccccgacgacagccgtgatcgag
gtcggcggcatcggcatggccgtccagtgcacccccggcaccctcgccgggctgcggatc
ggcacggacgcgcggctggccacctcgctcgtggtccgggaggactccctcaccctgtac
ggcttcgcggacgacgacgagcggcaggtcttcgaactgctccagaccgccagcggcgtg
ggcccccggctcgcccaggcgatgctcgccacccacagccccgacgccctgcgcaccgcc
gtcgccaccggtgacgagaaggccctcaccgccgtgtccggcatcggcaagaagggcgcc
cagaagctcctcctcgaactcaaggaccggctcggcgacccggtcggcgcgcgcatcggg
cagcagggcgtcggcacccccgtcagctcctcctggcgcgaccagctgcaggccgccctc
atcggcctcggctacgccacccgggaggccgacgaggcggtgaccgccgtgacaccgcag
gccgaggcggcgatcgccgggggcggccaggcccccgtaccccagctgctccgcgcagcc
ctgcagacgctcaaccgcgcacgctga

DBGET integrated database retrieval system