KEGG   Streptomyces flavogriseus: Sfla_5377Help
Entry
Sfla_5377         CDS       T01647                                 

Definition
aspartate carbamoyltransferase
Orthology
K00609  
aspartate carbamoyltransferase catalytic subunit [EC:2.1.3.2]
Organism
sfa  Streptomyces flavogriseus
Pathway
Pyrimidine metabolism
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Class
Metabolism; Nucleotide metabolism; Pyrimidine metabolism [PATH:sfa00240]
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:sfa00250]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
6165325..6166341
Genome map
AA seq 338 aa AA seqDB search
MLRPPGDNPRTPRHLISAADLTRDDAVLILDTAEEMARVADRPIKKLPTLRGRTVVNLFF
EDSTRTRISFEAAAKRLSADVINFSAKGSSVSKGESLKDTALTLEAMGADAVVIRHGASG
APYRLATSGWIDSAVVNAGDGTHEHPTQALLDAFTMRRRLVGPDAGIGRDLDGRRITIVG
DILHSRVARSNVHLLHTLGAHVTLVAPPTLVPVGVERWPCDVSYRLDDVLPKSDAVMMLR
VQRERMNAAYFPTEREYSRRYGLDGERMARMPEHAIVMHPGPMVRGMEITAEVADSDRCT
AVEQVANGVSTRMAVLYLLLGGSETALPSAAARTEENK
NT seq 1017 nt NT seq  +upstreamnt  +downstreamnt
atgctgcgccctcccggggacaacccccggaccccccgtcacctcatctcggccgcagac
ctcacccgcgacgacgccgtcctgatcctcgacaccgccgaggagatggccagggtcgcg
gaccggccgatcaagaagctccccaccctgcgtggacgaacggtcgtcaacctcttcttc
gaggactcgacccgtacccggatctccttcgaggccgccgccaagcgcctctccgccgac
gtcatcaacttctccgcgaagggctcctccgtctccaagggcgaatccctcaaggacacc
gccctgaccctggaggccatgggcgccgacgccgtcgtcatccggcacggcgcctccggc
gccccgtaccgcctcgcgacctccggatggatcgacagcgccgtcgtcaacgccggtgac
ggaacgcacgagcaccccacccaggcgctgctggacgcgttcaccatgcgccgccggctg
gtcgggcccgacgcggggatcggccgcgacctggacggccggcggatcacgatcgtcggc
gacatcctgcacagccgcgtggcccgcagcaacgtccacctgctgcacacgctcggcgcg
cacgtcaccctggtcgcgccgcccaccctcgtgccggtcggcgtcgagcggtggccgtgc
gacgtcagctaccggctcgacgacgtgctgccgaagtcggacgcggtcatgatgctccgt
gtacagcgtgagcggatgaacgccgcctacttcccgaccgagcgcgagtactcccggcgc
tacggcctggacggcgagcgcatggcgcggatgcccgagcacgccatcgtgatgcacccc
ggcccgatggtccgcggcatggagatcacggccgaggtcgccgactccgaccgctgcacc
gccgtcgaacaggtggcgaacggcgtctccacccgcatggccgtcctgtacctgctgctg
ggcggttccgagaccgccctgccgtccgccgccgcccgtaccgaggagaacaagtaa

DBGET integrated database retrieval system