KEGG   Streptomyces pratensis: Sfla_5377Help
Entry
Sfla_5377         CDS       T01647                                 

Definition
aspartate carbamoyltransferase
Orthology
K00609  
aspartate carbamoyltransferase catalytic subunit [EC:2.1.3.2]
Organism
sfa  Streptomyces pratensis
Pathway
Pyrimidine metabolism
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sfa00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    Sfla_5377
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    Sfla_5377
Enzymes [BR:sfa01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.3  Carboxy- and carbamoyltransferases
    2.1.3.2  aspartate carbamoyltransferase
     Sfla_5377
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
6165325..6166341
Genome map
AA seq 338 aa AA seqDB search
MLRPPGDNPRTPRHLISAADLTRDDAVLILDTAEEMARVADRPIKKLPTLRGRTVVNLFF
EDSTRTRISFEAAAKRLSADVINFSAKGSSVSKGESLKDTALTLEAMGADAVVIRHGASG
APYRLATSGWIDSAVVNAGDGTHEHPTQALLDAFTMRRRLVGPDAGIGRDLDGRRITIVG
DILHSRVARSNVHLLHTLGAHVTLVAPPTLVPVGVERWPCDVSYRLDDVLPKSDAVMMLR
VQRERMNAAYFPTEREYSRRYGLDGERMARMPEHAIVMHPGPMVRGMEITAEVADSDRCT
AVEQVANGVSTRMAVLYLLLGGSETALPSAAARTEENK
NT seq 1017 nt NT seq  +upstreamnt  +downstreamnt
atgctgcgccctcccggggacaacccccggaccccccgtcacctcatctcggccgcagac
ctcacccgcgacgacgccgtcctgatcctcgacaccgccgaggagatggccagggtcgcg
gaccggccgatcaagaagctccccaccctgcgtggacgaacggtcgtcaacctcttcttc
gaggactcgacccgtacccggatctccttcgaggccgccgccaagcgcctctccgccgac
gtcatcaacttctccgcgaagggctcctccgtctccaagggcgaatccctcaaggacacc
gccctgaccctggaggccatgggcgccgacgccgtcgtcatccggcacggcgcctccggc
gccccgtaccgcctcgcgacctccggatggatcgacagcgccgtcgtcaacgccggtgac
ggaacgcacgagcaccccacccaggcgctgctggacgcgttcaccatgcgccgccggctg
gtcgggcccgacgcggggatcggccgcgacctggacggccggcggatcacgatcgtcggc
gacatcctgcacagccgcgtggcccgcagcaacgtccacctgctgcacacgctcggcgcg
cacgtcaccctggtcgcgccgcccaccctcgtgccggtcggcgtcgagcggtggccgtgc
gacgtcagctaccggctcgacgacgtgctgccgaagtcggacgcggtcatgatgctccgt
gtacagcgtgagcggatgaacgccgcctacttcccgaccgagcgcgagtactcccggcgc
tacggcctggacggcgagcgcatggcgcggatgcccgagcacgccatcgtgatgcacccc
ggcccgatggtccgcggcatggagatcacggccgaggtcgccgactccgaccgctgcacc
gccgtcgaacaggtggcgaacggcgtctccacccgcatggccgtcctgtacctgctgctg
ggcggttccgagaccgccctgccgtccgccgccgcccgtaccgaggagaacaagtaa

DBGET integrated database retrieval system