KEGG   Streptomyces pratensis: Sfla_5385Help
Entry
Sfla_5385         CDS       T01647                                 

Definition
guanylate kinase
Orthology
K00942  
guanylate kinase [EC:2.7.4.8]
Organism
sfa  Streptomyces pratensis
Pathway
Purine metabolism
Metabolic pathways
Module
Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:sfa00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    Sfla_5385
Enzymes [BR:sfa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     Sfla_5385
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
6175304..6175921
Genome map
AA seq 205 aa AA seqDB search
MAATSRGTSPVPPDVRPRLTVLSGPSGVGKSTVVAHMRTVHPEVWLSVSATTRKPRPGER
NGVHYFFVDDEEFDKLIANGELLEWAEFAGNRYGTPRRAVLDRLEAGEPVLLEIDLQGAR
LVRQSMPEALLVFLAPPGWDELVRRLTGRGTEAPDVIERRLAAAKVELAAEEEFDTTLVN
TSVEDVARELLTLMLQASGLRGSDD
NT seq 618 nt NT seq  +upstreamnt  +downstreamnt
atggctgcaacatcccgggggacgtcccccgtacccccggacgtacgtccgcggctgacc
gtgctctccggcccctccggggtcggcaagagcacggtcgtcgctcatatgcgcaccgtg
caccccgaggtctggctctcggtgtcggcgacgacccgtaagccgcgccccggcgagcgc
aacggtgtccactacttcttcgtggacgacgaggagttcgacaagctgatcgccaacggc
gagctgctggagtgggccgagttcgccggcaaccgctacggcacgccccgccgggccgtg
ctcgaccgcctggaggcgggcgagccggtactgctggagatcgacctgcagggcgcacgg
ctggtccgccagtcgatgcccgaggcgctgctcgtcttcctcgcaccgcccggctgggac
gagctggtgcgccggctcaccggccgcggcaccgaggcgcccgacgtgattgagcggcga
ctggcggcggcgaaggtggaactggccgcggaggaggagttcgacacgacgctcgtcaac
acctccgtcgaggacgtcgcacgcgagctgctaacgttgatgctgcaggcttccggcctc
cgcggcagtgacgactga

  All links  
No link information was found.   
DBGET integrated database retrieval system