KEGG   Streptomyces pratensis: Sfla_5626Help
Entry
Sfla_5626         CDS       T01647                                 

Definition
phosphofructokinase
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
sfa  Streptomyces pratensis
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:sfa00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Sfla_5626
   01230 Biosynthesis of amino acids
    Sfla_5626
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Sfla_5626
   00030 Pentose phosphate pathway
    Sfla_5626
   00051 Fructose and mannose metabolism
    Sfla_5626
   00052 Galactose metabolism
    Sfla_5626
  Energy metabolism
   00680 Methane metabolism
    Sfla_5626
Enzymes [BR:sfa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     Sfla_5626
Protein phosphatases and associated proteins [BR:sfa01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     Sfla_5626
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(6440781..6441806)
Genome map
AA seq 341 aa AA seqDB search
MRIGVLTSGGDCPGLNAVIRSVVHRAVVDHGDEVIGFHDGWKGLLECDYRKLDLDAVGGI
LARGGTILGSSRVQPAHLRDGVERAKGHVTDLGLDAIIPIGGEGTLKAANLLSEAGLPIV
GVPKTIDNDIASTDVTFGFDTAVGVATEALDRLKTTAESHQRVLIVEVMGRHTGWIALHS
GMAAGAHAIVVPERPFDIAELTEVVGRRFSDGKKFAIVVVAEGAKPREGSMEFNQGKTDI
YGHERFAGVATQLSGELEQRLGKEARPVILGHVQRGGTPTAYDRVLATRFGWHAVEAAHR
GEFGMMTALRGTDITMVPLAAAVETLKTVPAERYAEAQVVL
NT seq 1026 nt NT seq  +upstreamnt  +downstreamnt
atgcgaattggtgtgctcacctccggcggcgactgccccggcctcaacgccgtcatccgt
tccgtcgtgcaccgcgcggtggtcgaccacggcgacgaggtcatcggcttccacgacggg
tggaagggcctcctcgagtgcgactaccgcaagctcgacctcgacgcggtcgggggcatc
ctggcccgcggcggcaccatcctcgggtcctcccgcgtccagcccgcgcatctgcgtgac
ggcgtggaacgcgctaagggccacgtcaccgacctcggcctggacgcgatcatcccgatc
ggcggcgagggcaccctgaaggccgccaacctgctctccgaggcgggtctgccgatcgtc
ggggtgccgaagaccattgacaacgacatcgcctccaccgacgtgacgttcggtttcgac
acggccgtcggggtcgccaccgaggcgctggaccggctgaagacgaccgcagagtcgcac
cagcgcgtcctgatcgtcgaggtcatgggacggcacaccggctggatcgcgctgcactcc
ggcatggcggccggggctcacgccatcgtcgtgcccgagcggcccttcgacatcgcggag
ctgaccgaagtcgtcggccggcgcttctcggacggcaagaagttcgcgatcgtcgtcgtg
gcggagggcgccaagccccgggagggctccatggagttcaaccagggcaagacggacatc
tacggccacgagcgcttcgccggtgtggcgacgcagctctccggtgagctggagcagcgc
ctcggcaaggaggcccgcccggtgatcctcggccacgtccagcgcggcggcaccccgacc
gcgtacgaccgcgtcctggccacccgcttcggctggcacgccgtggaggccgctcaccgc
ggcgagttcggcatgatgacggcgctgcgcggcacggacatcacgatggttccgctggcg
gcggccgtggagaccctgaagacggtcccggccgagcgctacgccgaggcccaggtcgtg
ctctga

DBGET integrated database retrieval system