KEGG   Streptomyces flavogriseus: Sfla_5626Help
Entry
Sfla_5626         CDS       T01647                                 

Definition
phosphofructokinase
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
sfa  Streptomyces flavogriseus
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Class
Metabolism; Overview; Carbon metabolism [PATH:sfa01200]
Metabolism; Overview; Biosynthesis of amino acids [PATH:sfa01230]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:sfa00010]
Metabolism; Carbohydrate metabolism; Pentose phosphate pathway [PATH:sfa00030]
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:sfa00051]
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:sfa00052]
Metabolism; Energy metabolism; Methane metabolism [PATH:sfa00680]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(6440781..6441806)
Genome map
AA seq 341 aa AA seqDB search
MRIGVLTSGGDCPGLNAVIRSVVHRAVVDHGDEVIGFHDGWKGLLECDYRKLDLDAVGGI
LARGGTILGSSRVQPAHLRDGVERAKGHVTDLGLDAIIPIGGEGTLKAANLLSEAGLPIV
GVPKTIDNDIASTDVTFGFDTAVGVATEALDRLKTTAESHQRVLIVEVMGRHTGWIALHS
GMAAGAHAIVVPERPFDIAELTEVVGRRFSDGKKFAIVVVAEGAKPREGSMEFNQGKTDI
YGHERFAGVATQLSGELEQRLGKEARPVILGHVQRGGTPTAYDRVLATRFGWHAVEAAHR
GEFGMMTALRGTDITMVPLAAAVETLKTVPAERYAEAQVVL
NT seq 1026 nt NT seq  +upstreamnt  +downstreamnt
atgcgaattggtgtgctcacctccggcggcgactgccccggcctcaacgccgtcatccgt
tccgtcgtgcaccgcgcggtggtcgaccacggcgacgaggtcatcggcttccacgacggg
tggaagggcctcctcgagtgcgactaccgcaagctcgacctcgacgcggtcgggggcatc
ctggcccgcggcggcaccatcctcgggtcctcccgcgtccagcccgcgcatctgcgtgac
ggcgtggaacgcgctaagggccacgtcaccgacctcggcctggacgcgatcatcccgatc
ggcggcgagggcaccctgaaggccgccaacctgctctccgaggcgggtctgccgatcgtc
ggggtgccgaagaccattgacaacgacatcgcctccaccgacgtgacgttcggtttcgac
acggccgtcggggtcgccaccgaggcgctggaccggctgaagacgaccgcagagtcgcac
cagcgcgtcctgatcgtcgaggtcatgggacggcacaccggctggatcgcgctgcactcc
ggcatggcggccggggctcacgccatcgtcgtgcccgagcggcccttcgacatcgcggag
ctgaccgaagtcgtcggccggcgcttctcggacggcaagaagttcgcgatcgtcgtcgtg
gcggagggcgccaagccccgggagggctccatggagttcaaccagggcaagacggacatc
tacggccacgagcgcttcgccggtgtggcgacgcagctctccggtgagctggagcagcgc
ctcggcaaggaggcccgcccggtgatcctcggccacgtccagcgcggcggcaccccgacc
gcgtacgaccgcgtcctggccacccgcttcggctggcacgccgtggaggccgctcaccgc
ggcgagttcggcatgatgacggcgctgcgcggcacggacatcacgatggttccgctggcg
gcggccgtggagaccctgaagacggtcccggccgagcgctacgccgaggcccaggtcgtg
ctctga

DBGET integrated database retrieval system