KEGG   Streptomyces flavogriseus: Sfla_5761Help
Entry
Sfla_5761         CDS       T01647                                 

Definition
ROK family protein
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
sfa  Streptomyces flavogriseus
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Class
Metabolism; Overview; Carbon metabolism [PATH:sfa01200]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:sfa00010]
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:sfa00052]
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:sfa00500]
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:sfa00520]
Metabolism; Biosynthesis of other secondary metabolites; Streptomycin biosynthesis [PATH:sfa00521]
Metabolism; Biosynthesis of other secondary metabolites; Butirosin and neomycin biosynthesis
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
6595812..6596780
Genome map
AA seq 322 aa AA seqDB search
MHTDLVAALDIGGTKIAGALVDGGGSLLVRAQRPTPAREGAEAVMGAVNDVLAELAASPL
WHRARAVGIGSAGPVDASAGTVSPVNVPGWRGFPLVDRVAAATGGLPVTLVGDGVAMTAA
EHWLGAARGYDNALCMVVSTGVGGGLVLGGKLHPGPSGNAGHIGHISVDLDGDPCPCGAR
GCVERIASGPNIARRALENGWRPGADGDTTAAAVAAAARAGDPVAAASFERAAQALAAGI
AATATLADLDIAVIGGGVAGAGEVLFAPLRASLRDYATLSFVQGLTVTSAVMGADAGLVG
AAAAASTVRRAASNGVRAVAAP
NT seq 969 nt NT seq  +upstreamnt  +downstreamnt
atgcataccgacctcgtcgccgcgctcgacatcggcggtaccaagatcgccggggcgttg
gtggacggcggcggatccctcctcgtacgggcgcagcgcccgacgccggcccgcgagggt
gccgaggccgtgatgggtgcggtgaacgacgtcctggcggagctggccgcctcgccgctg
tggcaccgcgcgcgtgcggtcggcatcggcagcgcggggcccgtggacgcctcggccggc
acggtgagcccggtgaacgtccctggctggcgcgggtttccgctggtggaccgggtggcc
gcggcgacgggcggactgccggtcacgctcgtcggtgacggggtcgcgatgaccgccgcc
gaacactggctgggcgccgcacgcggctatgacaacgccctgtgcatggtcgtctccaca
ggggtcggcggaggtctcgtactcggtggcaagctgcacccgggtccctccggcaacgcc
ggtcacatcggtcacatcagtgtggacctggacggcgacccgtgcccctgcggtgcgcgc
ggctgtgtcgaacgcatcgccagcgggcccaacatcgcgcgccgcgctctggagaacggc
tggcgccccggtgcggacggcgacaccacggccgccgccgtggccgccgccgcgcgtgcg
ggggacccggtcgcggccgcctccttcgaacgggccgcgcaggcgctcgcagccgggatc
gccgccaccgcgaccctggccgacctcgacatcgcggtgatcggcgggggagtggccggc
gccggagaggtgctcttcgcacccctgcgcgcgtccttgcgcgactacgccacgctctcc
ttcgtccaggggctcaccgtgacctccgccgtgatgggcgccgacgcgggcctggtcggg
gcggcggccgcggcctcgacggtccgccgcgctgcctccaacggcgtgcgggctgtcgcc
gccccgtag

DBGET integrated database retrieval system