KEGG   Streptomyces flavogriseus: Sfla_5911Help
Entry
Sfla_5911         CDS       T01647                                 

Definition
beta-galactosidase
Orthology
K12308  
beta-galactosidase [EC:3.2.1.23]
Organism
sfa  Streptomyces flavogriseus
Pathway
Galactose metabolism
Class
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:sfa00052]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
6773471..6775552
Genome map
AA seq 693 aa AA seqDB search
MTPASERHWLRPPSDDRPASFAYGADYNPEQWPREVWKDDVRLMREAGVTVVSVAIFSWA
RLQPAQDRWDFEWLDEVLDLLHSNGISVDLATATASPPPWLTTLHPEILPVTRTGETLSQ
GARQHWRPTSPVFRKYALELVEVMATRYADHPAVVAWHISNELGCHNIYDYSDDAAQAFR
DWLRARYGTLDELNRAWATSFWSQYYGDWAQILPPRLAASHANPTQQLDFKRFSSDALKD
YLRAEREVLRRVTPHIPATTNFMVMGETMGMNYPDWAEEIDFVSNDHYAHPGPQRLDELS
FSAALTHSIAQGKPWFLMEHSTSAVNWQPVNVAKREGELARDSLVHVAHGADAVCFFQWR
QSAAGAEKHHSAMVPHAGPDSEVFRAVAALGRTLETLTPVTGSVREPARAALVFDWESWW
AVERDSQPSSLVRYRQEALDWYSAFLALGVRVDVVTTTADLTGYDFVAAPVLNVVPLELA
ARLDAYVRGGGHLATTYYSGVVDENDHVHLGGYPGALRDLLGIRIEEFGPLLEDVEVRLD
NGLTGTLWTDRIDVTAPDEVTVLARYETGDQAGRPAVTRRAPEGGGSAAYVSTRLGRHGL
PEVLRPLLSGAGVHSELPAEARGLVELTVRTDGSQAYWFLVNRTDEPVAFDAVAGEVLSG
PAPTDGGGLVLPSRGVAVLRLASGGTPFRDTSA
NT seq 2082 nt NT seq  +upstreamnt  +downstreamnt
atgacccccgcctccgagcgccactggcttcgcccgccctccgacgaccgccccgcgagc
ttcgcctacggggccgactacaacccggagcagtggccgcgcgaggtgtggaaggacgac
gtccggctgatgcgcgaggccggcgtcaccgtcgtctccgtcgccatcttctcctgggca
cgcctgcaaccggcccaggaccgctgggacttcgagtggctggacgaggtcctcgatctg
ctccacagcaacgggatctcggtggacctcgccaccgccaccgcctcgccgccgccgtgg
ctcaccaccctgcacccggagatccttcccgtcacccgcaccggtgagaccctctcccag
ggcgcgcgacagcactggcgtcccacctcacccgtcttccggaagtacgcgctggaactg
gtcgaggtgatggccacccgctacgcggaccaccccgccgtggtcgcctggcacatctcc
aacgagctcggctgccacaacatctacgactactccgacgacgcggcccaggccttccgc
gactggctgcgcgcacgctacggcaccctggacgagctcaaccgggcctgggcgacctcc
ttctggtcccagtactacggcgactgggcacagatcctgcccccgcgactggccgcgagc
cacgccaacccgacgcagcagctcgacttcaagcgcttctcctccgacgcgctgaaggac
tacctccgggccgaacgcgaggtcctgcgccgcgtcaccccgcacatccccgccaccacc
aacttcatggtgatgggcgagaccatgggcatgaactacccggactgggcggaggagatc
gacttcgtctccaacgaccactacgcccaccccggcccgcagcgtctcgacgagctctcc
ttctccgccgccctcacgcactccatcgcccagggcaagccctggttcctgatggagcac
tccacgagcgcggtcaactggcagcccgtcaacgtcgccaagcgcgagggcgaactggcc
cgcgactcgctcgtccacgtcgcccacggagccgacgccgtctgcttcttccagtggcgc
cagtccgccgcgggcgccgagaagcaccactccgcgatggtgccccacgccgggcccgac
agcgaggtgttccgcgccgtggcggccctcggccgcacgctggagacactcaccccggtc
accggttccgtccgggaaccggctcgcgcggccctggtgttcgactgggaatcctggtgg
gccgtcgagcgtgactcccagccgtcctccctggtgcgctaccgtcaggaggcgctcgac
tggtactcggccttcctggccctcggggtccgggtggacgtcgtcaccaccacggccgac
ctcaccggctacgacttcgtcgccgcacccgtcctgaacgtggtgcccctggaactcgcc
gcccggctggacgcctacgtgcgcggcggcggccacctcgccaccacctactactcgggt
gtcgtcgacgagaacgaccacgtccacctcggcgggtaccccggagccctgcgcgatctg
ctgggcatccgcatcgaggagttcggccccctcctggaggacgtggaggtacgcctcgac
aacggtctcaccggcacgctgtggaccgaccgcatcgacgtcaccgcacccgacgaggtc
accgtcctcgcacggtacgagaccggcgaccaggcgggccgccccgccgtcaccaggcgc
gccccggagggcggcggctccgccgcgtacgtctccacccggctcggccgccacggactg
cccgaggtgctgcgccctctgctgtccggcgccggcgtgcacagcgagcttcccgccgag
gcgcgcgggctggtcgagctgaccgtgcggaccgacggctcgcaggcctactggttcctc
gtcaaccgtaccgacgagcccgtcgcgttcgacgcggtggccggagaggtcctctccggg
cccgcgccgaccgacgggggcggcctcgtccttccctctcggggggtcgccgtgctccgc
ctggcatcgggcggcacgcccttccgggacacatccgcgtag

DBGET integrated database retrieval system