KEGG   Streptomyces pratensis: Sfla_6000Help
Entry
Sfla_6000         CDS       T01647                                 

Definition
anti-sigma-factor antagonist
Orthology
K01425  
glutaminase [EC:3.5.1.2]
Organism
sfa  Streptomyces pratensis
Pathway
Alanine, aspartate and glutamate metabolism
Arginine and proline metabolism
D-Glutamine and D-glutamate metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sfa00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    Sfla_6000
   00330 Arginine and proline metabolism
    Sfla_6000
  Metabolism of other amino acids
   00471 D-Glutamine and D-glutamate metabolism
    Sfla_6000
Enzymes [BR:sfa01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.2  glutaminase
     Sfla_6000
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
6877920..6879272
Genome map
AA seq 450 aa AA seqDB search
MSASEAVTDALRELHARFAGVDEGRQADYIPELTRSDPDDFGLALVSMDGHAYSAGAADT
PFTLQSVSKPFVYALALAALGLDEVSRWVGAEPSGEAFNAISLEPGTGRPANAMVNAGAI
VTTALVPDSREEPAFGRILSCLSRFAGRKLDVDEDVHGSEAATGDRNRALAYLIRSTGSL
PVDPVQAVDTYFRQCAVRATAVDLAVMAATLAYGGVNPVTGERVVSPEVAAQVLAVMATC
GMYDSSGDWLLRVGLPAKSGVSGGLLAAGPARFGLAAYSPLLDASGTSVRGRAALGALSE
RLGLHLMRNPALPGSTVTLVTTADVLPSAPTGRLARALHERVGVVAAQGALDFTAAERVL
YALDESGSEDGGPVVLDLREVTGADSDALVLLHAGLSRLAREGRRAAVVDPGDRLGPPDL
LRERTGQDLPRFGSREEAAEQCARVLAGPG
NT seq 1353 nt NT seq  +upstreamnt  +downstreamnt
gtgagcgcctccgaggccgtgacggacgcgctccgcgaactccacgcacgcttcgccggc
gtggacgagggccgacaggccgactacatccccgagttgaccaggtcggatcccgacgac
ttcgggctcgccctcgtgagcatggacgggcacgcctacagcgccggggcggcggacacc
cccttcaccctgcagtcggtgtccaagcccttcgtctacgccctcgcgctggccgcgctc
ggcctcgacgaggtgagccgttgggtgggcgccgaaccgagcggcgaggcgttcaacgcc
atcagcctggaacccggtaccggacggcctgccaacgcgatggtcaacgcgggcgccatc
gtgaccaccgccctggtccccgacagccgcgaggaacccgcgttcggccgcatcctgagc
tgtctgagccggttcgccgggcggaagctggacgtcgacgaggacgtccacggctccgag
gcggccaccggggaccgcaatcgggcgctcgcctatctgatccgcagcacgggaagcctg
cccgtcgacccggtgcaggcggtggacacctacttccggcagtgcgcggtgcgggccacg
gcagtcgatctcgccgtgatggcggcgaccctggcctacggcggtgtcaatccggtcacc
ggggagcgggtcgtctcccccgaggtcgcggcccaggtcctcgccgtcatggcgacctgc
ggaatgtacgactcctccggcgactggctgctcagggtcgggctgcccgccaagagcggg
gtctccggcggcctgctcgccgccgggccggcccgcttcggtctggccgcctacagcccg
ctcctggacgcgtcgggcacctcggtacgcggccgcgcggcgctcggcgcgctctcggaa
cgtctcgggctccacctcatgaggaacccggcccttcccggctccaccgtcaccctggtc
accaccgccgacgtgctcccctcggccccgaccggccggctcgcacgcgctctccacgaa
cgcgtgggtgtcgtcgccgcccagggcgcactcgacttcaccgcggcggagcgtgtgctg
tacgcgctcgacgagtcgggctcggaggacggcgggcccgtggtgctcgacctgcgggag
gtgaccggcgccgactccgacgccctcgtgctgctgcacgccggcctctcccggctcgcg
cgggagggcaggcgtgcggccgtcgtcgatccaggcgaccggctgggtcccccggacctg
ctccgcgagcggaccggccaggacctgccgcgcttcggctcccgcgaggaggccgccgaa
cagtgcgcgcgggtcctggccggtccaggctga

DBGET integrated database retrieval system