KEGG   Spirochaeta africana: Spiaf_0130Help
Entry
Spiaf_0130        CDS       T01811                                 

Definition
succinyl-CoA synthetase subunit beta
Orthology
K01903  
succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
sfc  Spirochaeta africana
Pathway
Citrate cycle (TCA cycle)
Propanoate metabolism
C5-Branched dibasic acid metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Class
Metabolism; Overview; Carbon metabolism [PATH:sfc01200]
Metabolism; Carbohydrate metabolism; Citrate cycle (TCA cycle) [PATH:sfc00020]
Metabolism; Carbohydrate metabolism; Propanoate metabolism [PATH:sfc00640]
Metabolism; Carbohydrate metabolism; C5-Branched dibasic acid metabolism [PATH:sfc00660]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
157495..158721
Genome map
AA seq 408 aa AA seqDB search
MRLLEYQGKDVFRRAGLAVPQARLLTVESPGQCAEAVRTAAGELLQTGGAEHDAKKPATA
GAGPDAAEPATAGAARVVVKAQVNMGGRGKAGLIKLADSPDTAAAAAAEILATPYSVPRL
LVEEAVDLERELYLSISPDAGSARFIVLASLEGGVEIEELARERPDAIKRLSIDPIAGLQ
PYQSRELAYDLGLAGDVARQFARLVAALYRVFRDNDAELAEINPVFLTRDGRLVAGDAKL
IIDDNSLDRQPQFEISREQFESDAAYESALEGIPYVQFDGDISLMCAGAGLTTTVYDLVN
FEGGTVANYLEFGGPNYHKAQRAMELCLQNRSKVILVVTFGTIARADVMADGVVEAIRNL
QPDRPIVTCIRGTNEEAAEQTLRAAGLEPLFDAEEAVRTAVALARERA
NT seq 1227 nt NT seq  +upstreamnt  +downstreamnt
gtgagattacttgagtatcagggaaaggacgtgttccgtcgtgccggtctggcggtgccg
caggcgcgcctgctgacggtcgagtcacccgggcaatgcgccgaagcggtccggaccgca
gccggggaactgctgcagaccggtggcgccgaacatgatgcaaaaaagccggcaactgcc
ggtgccggaccggacgccgcggagccggcaactgccggtgctgcccgggttgtggtaaag
gcgcaggtgaacatgggggggcgcggcaaggccgggttgatcaagctggccgacagcccg
gatacagcagccgcggcggctgcagagatcctggcgaccccctacagcgtgccccggctg
ctggtcgaggaagcggttgatcttgaacgtgaactgtacctctcgatctcgccggatgcc
ggcagcgcccgctttatcgttctggcgtcgctggaaggcggggtggagatcgaggagctg
gccagggagcgccccgatgcaatcaagcggctgtccattgatccgatcgcgggactgcag
ccgtaccagagtcgggaactggcgtatgatctggggcttgccggcgatgttgccagacag
tttgcccgtctggttgccgccctgtaccgcgtgtttcgcgacaacgatgccgagctggcc
gagatcaacccggtattcctgacgcgcgacggcaggctggtggccggggatgccaagctg
attatcgatgacaacagtctggaccggcagccgcagttcgagataagtcgcgagcagttc
gagtcggatgcggcctatgagtccgccctggaggggataccctatgtgcagtttgatggg
gatatctcgttgatgtgcgcaggggccggtcttaccaccacggtttatgacctggtgaat
ttcgagggcggtactgtcgccaactatctggaattcggcgggccaaactatcacaaggca
cagcgggccatggagctgtgtctgcagaaccgcagcaaggtgatcctggtggtgaccttt
ggcacgattgcccgggctgatgtaatggccgacggggtggtagaggccatccgtaatctt
cagcccgatcgcccgatcgtcacctgcattcgcggtaccaacgaggaagcagccgaacag
accctgcgggcggccggactggagccactgttcgatgccgaagaggcggttcgcaccgcc
gtagcgctggcccgggagagagcataa

DBGET integrated database retrieval system