KEGG   Spirochaeta africana: Spiaf_0215Help
Entry
Spiaf_0215        CDS       T01811                                 

Definition
PAS domain-containing protein
Orthology
K13924  
two-component system, chemotaxis family, CheB/CheR fusion protein [EC:2.1.1.80 3.1.1.61]
Organism
sfc  Spirochaeta africana
Pathway
Two-component system
Bacterial chemotaxis
Brite
KEGG Orthology (KO) [BR:sfc00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    Spiaf_0215
 Cellular Processes
  Cell motility
   02030 Bacterial chemotaxis
    Spiaf_0215
Enzymes [BR:sfc01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.80  protein-glutamate O-methyltransferase
     Spiaf_0215
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.61  protein-glutamate methylesterase
     Spiaf_0215
Two-component system [BR:sfc02022]
 CheA family
  CheA-CheYBV
   Spiaf_0215
Bacterial motility proteins [BR:sfc02035]
 Flagellar system
  Chemotaxis proteins
   Two component system proteins
    Spiaf_0215
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
265384..270138
Genome map
AA seq 1584 aa AA seqDB search
MPAQYLVGIGASAGGLEALQALLSSVEPRKAGSMAIVIAQHVSPTYKSQLVELLSRQTAL
PIGEVVDGESPQGGRVYITPPDRDVAFASGRFVLTRPASGHGPRPSVDEFFCSLAENYQA
AAAAIVLSGTGSDAAHGVMAIHAAGGLVMVQDPASAKYDGMPAAAIETRAVDVVAEPHVI
GSSLWSWLQQGAQAFRVDKAGRSLHTGSAVEHIMQLLSDRTGTDFSRYKPATIGRRLEKR
LSSLGIDSIEDYLELLRSSAGELDELFSTILIGVTYFFRDAESFDALREQLEQRLLQIGQ
AERIRIWVPGCATGEEAYSVAILAADILGDRIGVADIQIFATDLDEKALSVARRGRYPGT
ALENMPQHLRSSYFIADGDMYEVVPAIRSLVLFSRHDVTSNPPFLKLDLISCRNLLIYFG
QELQQHVVPLFHYALKPEGLLFLGKSETIGGFSDLFETLSTRHKVYRRTRGSNPYANRAL
SFTAHAMPSRRRQIPKKREYTIADMVKDTLYHSFEHPYVVVNNTMEVMEVAGDVRDYLSI
KTGAMSSDLITLIDDRYEIELRSLLTAAIRDNTPATGNLRRLPGDDRRMLRFQIKPLLYS
GSSDALYLVVFEHLQLDEYSMPGRQEDSGDATMRERELELELAATREHLQNYIEELETST
EELQSLNEELQSTNEELQSSNEELETSNEELQSTNEELQIAYTELKNLNDEAEQQREQLH
RSEVNLRAVLENTLQGFLLLDRSYRVVVRNETAAVMLHQLSGAEVTADPLIIDYLPGDEI
EMFHHSISRCMQGETVAKTRRMVYADGSEHWLLLQFTPVPVDDDGQIQLISLAVLDITER
KESELALSEEKQLNQLILDSAQVGICLTGIEGNFEQVNAGYCSLYGYTAEELVGKPFSMV
LPPGMRDYAERLHKRYLQGQTEESSGEWEVLRKDGTRLTVLVGAGRLHKRDGSVYKVTTV
VDITAQKQAEEERNRLFTVSLDLMGILRYDGFFQHVNPAWVSTLGYAKDRLLQEPLIELV
HTDDRRRTLDFFRALIEKPQTPVSFENRCIAADGTVRWLSWNIAVVPEQRQMYVVARDVT
DSRRYQNLLRDTQSVAKVGGWELDTDTEHISWTDEVYHIYDLPAGQPVDYELALSTYEPR
DQELIREAIAKAVEYGESSDLEVRFTSHVGRQLWVRVTFKGVAIDGTAGKVIGTIQDITL
QKQAELENLRLSLAASRTDNGVVIADHSFRLEWVNHGFEVMTGYKLSEIKARQLDKALLR
MGASGKAVRQINQGIATQQSLHEELELRRRNGQECWVRLDITPVLDDDGQLVNWVALVHD
ITGQKEFQTELIEARNRAEEMNRLKSSFLANMSHEIRTPLNGILGMANIIRRDAGDAGIR
DYADLLEQSGQRLLRTINQVLDLSKLEAHQTELFLEPMELNQLVQQVHDSIEPAVQEKQL
QLVLKPHPEPLYAEGDSYLVENILLNLLNNAIKFTDEGQVTIRIRTRVVDGSPCAAVEVT
DTGIGMSPEYLSRLFVPFSQESTGQARRYEGTGLGLSISREYAVLMDGDIQVESKKGTGS
TFRLLLPMADRETGRGEHETRVDS
NT seq 4755 nt NT seq  +upstreamnt  +downstreamnt
atgccggctcagtatctggttggcattggggcatcggccggtggtctggaggccctgcag
gcattgctcagcagcgttgagccccgcaaggctgggtctatggcaatcgttattgcccag
catgtaagccctacctataaaagccagctggtagagctgctgtcgcgtcagacggcgctg
ccgatcggggaggtggtcgacggtgaatccccccagggtggacgggtatatattaccccg
ccggatcgggatgtggcctttgcatccgggcggtttgtgcttaccaggccggcatcaggg
cacgggccgcgcccaagcgtcgatgagttcttctgcagcctggcagaaaactaccaggct
gcggcagcggcgatcgtgctgtccggcaccggctctgatgcagcacacggggtgatggcg
attcatgcagcaggcggcctggtgatggtacaggatcctgccagcgcgaagtacgacggc
atgccggctgccgctattgaaacccgggcagtcgacgtagttgccgagccgcacgtgatc
ggttccagtctctggagctggctgcagcagggggcgcaggcattccgggtggacaaggca
ggacggtcactgcataccggtagtgccgtcgagcatatcatgcagctgctgtcggatcgg
acaggcacggatttctcacgctacaaaccggccaccatcggccggcggctggagaaacgg
ctgagcagtctggggatagattcgatcgaggactatctcgagctgctgcgcagcagtgcc
ggggagctggatgagctgttttccacgatcctgatcggggtaacctattttttcagggat
gccgaatccttcgatgccctgcgcgagcagttggagcagcggctgctgcagatcggtcag
gccgaacgtatcaggatctgggtgccaggctgtgcaaccggggaggaggcttactcggtg
gcaatcctggctgccgatatcctgggggatcggatcggggtcgctgatatacagatattt
gctaccgatctcgacgagaaagcactgagcgttgcccgccgcggccggtacccggggacc
gcattggagaatatgccgcaacacctgcgcagcagctattttattgctgacggtgatatg
tatgaggttgttccggcgatccgttcgctggtactcttctctcgtcatgatgtaaccagt
aatcccccgtttctgaagcttgatctgatcagctgtcggaatctgctgatttattttggc
caggagctgcagcagcatgtggtgccgctgttccattacgcccttaagccggaagggctg
ctgtttctggggaaaagtgaaaccatcggggggttcagcgatctgttcgagaccctctct
acccggcacaaggtgtaccgccgcacccgcggctccaatccctacgccaaccgcgcgctg
agttttaccgcgcatgccatgccgtcgcgccgacgccagatcccgaaaaaacgggagtac
accattgccgacatggtcaaggataccctgtaccacagctttgagcacccctacgtggtg
gtgaacaacactatggaggtgatggaggtcgccggtgatgtgcgggactatctttccatc
aagaccggggccatgagctccgatctgatcaccctgatagacgaccgctacgaaatcgag
ctgcgcagcttgctcaccgcggcaatccgggacaataccccggcgaccggaaatctgcgc
cgcctgcccggggatgaccggcgcatgctgcgttttcagataaaaccgctgctgtattcc
ggcagcagtgacgcgctgtacctggtggtctttgagcacctgcagctggatgagtatagt
atgccgggccggcaggaggatagcggtgatgccaccatgcgtgagcgcgagctggagctc
gagctggccgctacccgcgagcatctgcagaactatatcgaggagctggaaacatctacc
gaggaactccagtcattgaatgaggaacttcagtcaaccaatgaagagctccaatcctcc
aacgaggagctcgagacctcgaacgaggaactgcagtctaccaacgaggagctgcagatt
gcctataccgagctgaagaaccttaacgacgaggcagagcagcagcgtgagcagctgcat
cgctccgaggtcaatctgcgtgccgtactggagaataccctgcagggatttctgctgttg
gatcgttcctatcgggtagtggttcgtaacgagactgccgcagtcatgctgcaccagctg
tcgggggccgaggtgacggccgaccctcttattatcgactatctgccaggcgatgagatc
gagatgtttcaccactcgatctctcgctgcatgcagggtgaaactgtggccaagacgcga
cggatggtgtatgccgatgggtcagaacactggctgctgctgcagttcaccccggttccg
gtcgatgacgatgggcagatccagctgatttcgctggcagttctggatataaccgaacgt
aaggaatcagagctggcactgtcggaggagaaacagctgaaccagctgatcctggacagt
gcccaggtaggtatctgtctcaccggtatcgaggggaatttcgagcaggtgaatgccggc
tactgcagtctctatggctataccgccgaagagcttgtcggaaagcccttttccatggtc
ctgccgccgggaatgcgggattatgccgagcgactgcataaacggtacctgcagggccag
accgaggagagctccggcgagtgggaggtcctacgcaaggatggaactcgcctcacggtg
ctggtgggggccggccgtttgcacaaacgagacggcagcgtctacaaggttaccaccgtg
gtggatattaccgcccagaaacaggcagaggaggagcgtaatcgcctgtttaccgtctcc
ctggatcttatgggcatccttcgttacgacggcttttttcagcatgtaaatcctgcctgg
gtcagtacactgggctacgccaaggatcggctgctgcaggagccgctgattgaactggtg
cacaccgatgatcgccggcggacactggatttcttccgggcactcatcgaaaaaccccag
acaccggtcagctttgaaaatcgctgcatcgctgctgacgggactgtccgctggctatcc
tggaacatcgcggttgtaccggagcagcgacagatgtatgtggtagcccgcgatgtgact
gattctcgtcggtatcagaacctgctgcgcgatacccaaagcgtcgccaaggtaggcggc
tgggaactggacaccgataccgagcacatcagctggaccgatgaggtgtatcatatctac
gatcttcccgccgggcagccggttgactacgaactggccctgagcacctacgaacctcgg
gatcaggaactgatccgcgaagcgatcgccaaggccgtcgagtacggcgaatcatcggat
ctcgaggtgcgcttcaccagtcatgtcgggcgccagctctgggtccgggtgacctttaaa
ggggtggcgattgatggaactgccgggaaggtaatcggtaccatccaggacatcaccctg
cagaaacaggccgagctcgagaatctgcggctgtcgctggcggcaagccgcaccgataac
ggggtggtgattgccgaccacagtttccgtctggagtgggtgaaccacggattcgaggtg
atgaccggctacaagctgagcgagatcaaggcacggcagctggacaaggcactgctgcgc
atgggggcctccggcaaggcggtacggcagatcaaccaggggattgccacgcagcagtcg
ctgcatgaggaacttgaactgcggcggcgtaacggtcaggagtgctgggtccggctggat
ataaccccggtgctggatgacgacggtcagctggtgaactgggttgccctcgtacacgat
atcaccgggcaaaaggagttccagaccgagcttatcgaggccagaaaccgcgccgaggag
atgaatcggctcaagagcagctttctggccaatatgtcgcacgagatccgcaccccgctc
aatggtatcctggggatggccaatataatccgccgagacgccggtgatgcgggaattcgt
gactatgccgaccttctggagcaaagcggccagaggctgctgcggactatcaaccaggtg
ctggatctctcaaaactcgaggcccaccagaccgagctctttctggaacccatggagctt
aatcaactggtgcagcaggtgcatgactcaatcgaaccagcggttcaggaaaagcagctg
cagctggtacttaaaccgcatcccgagccgctgtatgccgagggggacagctatctggtc
gaaaatattctgttgaacttgctgaacaatgctattaagtttacagacgaggggcaggtc
accatacggatcagaaccagggtggttgacggcagcccctgtgccgcggtagaggtgaca
gataccggtatcgggatgagcccggagtatctgtcgagattgtttgtgccgttcagccag
gagagcaccggccaggctcgtcgctacgagggtaccggcctggggctgtctatttcccgc
gaatatgcggtactgatggacggagacatacaggtggagtcgaagaagggtacgggaagc
acatttcgactgctgctgccgatggctgatcgagaaacaggacgaggtgagcatgaaacg
cgtgttgatagttga

DBGET integrated database retrieval system