KEGG   Spirochaeta africana: Spiaf_0279Help
Entry
Spiaf_0279        CDS       T01811                                 

Definition
alpha-galactosidase
Orthology
K07407  
alpha-galactosidase [EC:3.2.1.22]
Organism
sfc  Spirochaeta africana
Pathway
Galactose metabolism
Glycerolipid metabolism
Sphingolipid metabolism
Brite
KEGG Orthology (KO) [BR:sfc00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    Spiaf_0279
  Lipid metabolism
   00561 Glycerolipid metabolism
    Spiaf_0279
   00600 Sphingolipid metabolism
    Spiaf_0279
Enzymes [BR:sfc01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.22  alpha-galactosidase
     Spiaf_0279
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
343335..345653
Genome map
AA seq 772 aa AA seqDB search
MIQFNDTTRTYSLHSGDMTYQLSIGSRGELIHAYVGGRLRSKAADGRTAETWFSRRRLPV
PYSCTTDPQDPTSSPQVLPGEWPGAGLGDFRHPAWQVQLADGSRAPQLRVVEHGTMPGLP
GPEGMPHLRQRKGDQTLRILLRDTAGRLEVELYYGVPEGQSAVVRWARVRCTDSAALTLQ
QADSFCLDLPDNDWHLLSLPGSWARERWLERLQLGRGTQQIESRRGISGHHASPWAALAR
PDATQDHGDVLAVALVYSGSFQLQAGVSDFFHTRFRGGLQPEGFSWELGPNQVFDTPQAV
ISFDTKGLNGISARLQSLVQDRILPPYWASRPRPALLNSWEGLYFDTTEKTVAELAEAAA
GLSVELFVLDDGWFRGRNDDTSSLGDWEPDPDKLPGGIAGIANKVCEQGIGFGLWIEPEM
ISPDSEMYRAHPEWCLQVPQGPGIQARNQLVLDLCKHEVVDYLAGIFTRLIGSAPISYIK
WDMNRNLTEAGSDSLPPHRQGEVAHRWMLGVYRLMSQITSAFPEVLFEGCAGGGGRCDLG
ALYYMPQYWISDDTDGMERLRIQYGTGMFVPPAAMSAHISDVPNHQVGRVTPLEFRAAVA
MSGSFGVELDARSMSAAEQAGIRSVLQRWRRYQPLLTRSRLQWILPPSWDSILPTRPVGG
NPSWSPGREAAWMFVSPESGGRRDRSSGGCPWMLVVYAQVLAAPAAAPRILRIPGLDPAG
EYRVVLEYSAAPGLQPQQEEFLTFGDDLHLRGLQLPYLAGDYRVIYIEVFPV
NT seq 2319 nt NT seq  +upstreamnt  +downstreamnt
atgattcagttcaacgacacaacccgtacttattccctgcattccggcgacatgacctat
cagctgagtattggcagccgtggtgagctgattcatgcctatgtcgggggacggctgcga
agcaaggctgccgatggccgcactgccgagacgtggttttcccgaaggcgtttgccggtg
ccgtattcctgcaccactgatccacaggacccgacatcatcccctcaggtgcttcccggt
gaatggccgggtgccgggttgggagatttccgccatccagcctggcaggtgcagctggca
gacggcagccgggcgccgcagctgcgggttgtggagcatggcaccatgccggggctgccg
gggccggaggggatgccccacctgcggcagcgcaagggggatcagaccctgcgcatcctg
ctgcgagataccgccgggcgcctggaggtcgaactgtattacggggtgccagaggggcag
tcggcggtggtgcgatgggcacgtgtgcgctgcaccgacagcgctgccctgaccctgcag
caggccgacagcttttgccttgacttaccggataacgactggcatctgctgagtctgccc
ggcagctgggcgcgtgagcgctggctggagcgactgcagctggggcgaggtacccagcag
atcgagagccgccgcggaatatccgggcatcatgcaagcccgtgggcggcgctggctcga
ccggacgcgacccaggatcatggcgatgtgttggcggttgccctggtatacagcggcagc
ttccagctgcaggcaggggtgagtgatttctttcacacccgctttcgcggggggctgcag
ccggagggattctcctgggaactgggccctaaccaggtgttcgatacccctcaggccgta
atctcctttgatacaaaaggtctgaacggtatcagtgcccggttgcagagcctggttcag
gaccgtatcctgccgccgtactgggccagtcgtccgcggccggccctgttgaacagctgg
gaggggttgtactttgacaccacagagaagactgttgctgaactggccgaggcagctgcc
gggctttcggtagaactgttcgtcctggacgatggctggtttcgcgggcgaaatgacgat
accagctcactgggtgactgggagccggatccggacaagctgcccggcgggatcgctggc
attgccaacaaggtctgtgaacagggaatcggattcggcctgtggattgagccagagatg
atcagccccgacagcgagatgtatcgcgcccaccccgaatggtgtctgcaggtgccccag
gggccgggtatacaggcgcgcaatcagctggtcctggacctctgcaagcatgaggtagtg
gattatctggcggggatctttaccaggctgataggctcggctccgatcagctacatcaag
tgggacatgaaccgcaacctgaccgaggcaggctccgacagcctgccgccgcaccgccag
ggagaggttgcccaccgctggatgctcggggtctatcgcctgatgtcgcagattacatcc
gcctttccggaggtgttgttcgaggggtgtgccggcggcggcggccgctgcgatctgggg
gcattgtattacatgccgcagtactggatcagtgatgataccgacgggatggagcggttg
cgtatccagtatggcaccggcatgtttgtgcccccggcggcaatgagcgcccatatctcg
gatgtgccgaatcaccaggtgggccgggtaaccccgctggagtttcgcgctgcggtagca
atgtcaggttccttcggtgtggagctggacgcacgcagcatgtctgctgccgagcaggcc
ggtatccgcagcgtactgcagcgctggcgccggtatcagccgctgctgacccggtctcgc
ctgcagtggatcctgccgccctcctgggactcgatcctgccgacgcgaccggttggcggg
aatccgtcctggtcgccgggtcgcgaggctgcctggatgtttgtctcaccggaatccggc
ggccggcgtgaccgctcttccggtgggtgcccgtggatgctggtggtgtatgcccaggtg
ctggcagccccggcggctgccccgcgcatcctgcgtatccccgggctggacccggccggg
gaataccgggtggtcctggagtacagtgctgccccgggtctgcagcctcagcaagaggag
ttcctcacctttggggacgacctgcatctgcgcggactgcagttgccctaccttgcgggt
gattatcgggtcatatatatcgaagttttcccggtgtag

DBGET integrated database retrieval system