KEGG   Spirochaeta africana: Spiaf_0325Help
Entry
Spiaf_0325        CDS       T01811                                 

Definition
glycerol kinase
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
sfc  Spirochaeta africana
Pathway
Glycerolipid metabolism
Metabolic pathways
Class
Metabolism; Lipid metabolism; Glycerolipid metabolism [PATH:sfc00561]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(402434..403939)
Genome map
AA seq 501 aa AA seqDB search
MDTRYILAFDAGTTSSRAILFDHDGNLAGTAQQEFPQIYPKPGWVEHDPMEIWATQSGVA
RQVLEKFGVRPDQIAGIGITNQRETAVVWDKNTGKPVYNAIVWQDKRTAGLCEQLRRDGM
TDTIRQKTGLVIDSYFSGTKIAWILENNPELRPRAEKGEILFGTVDTWLIWNLTRGKVHA
TDYSNASRTLLYNIHTLDWDDELLSALNIPRAMLPEVRPSSSIFGATDVRSFGAAEIPIA
GVAGDQQAALFGQGCFQKGMAKNTYGTGSFILMNTGSEPITSQTGLLTTIAWGTDSGVEY
ALEGSIFITGAAVQWLRDELKVIHDARDSEYFATKVADNGGVYVIPAFAGLGAPYWDMYA
RGTIVGMTRGTNMNHIIRATLESLAYQVRDVSECMATDSGIEMRELKADGGACANDFIMQ
YQSDILGVPVIRPKVIETTARGAAFLAGLATGFWKDLKDIQAHTEIDRVFEPSMDADQRE
ELYRGWRRAVDRSRGWIEQAE
NT seq 1506 nt NT seq  +upstreamnt  +downstreamnt
atggacacacgctacatcctggccttcgatgccggcacgacaagctcccgcgcgattctt
tttgatcacgacggcaacctggccggcactgcccagcaggaattcccgcagatatacccc
aaaccaggttgggtggaacatgatcccatggagatttgggctacccagagcggcgtcgcc
cgccaggtgctggagaaattcggggtacgccccgaccagatcgccggcatcggtatcacc
aatcagcgcgaaaccgccgtagtatgggacaagaacaccggcaagccggtgtacaacgcc
atagtgtggcaggataaacgcaccgccggtctgtgcgagcagctgcgccgggacggaatg
accgataccatccggcagaaaaccggcctggtaatcgactcctactttagcggcaccaag
attgcctggatcctggaaaacaaccccgaactgcgcccgcgtgccgaaaagggagagatc
ctgtttggcactgtcgacacctggctgatctggaacctgacccgcggcaaggtacatgcc
acggactactccaacgcctcgcgaacactcctgtacaatattcacaccctggactgggat
gatgagctgttgtccgccctgaacataccacgggccatgctgccggaggtccgcccctcc
agttcgatcttcggggccaccgacgtacgctcattcggcgccgccgagattccgattgca
ggggtggccggtgaccagcaggccgccctgttcgggcagggatgcttccagaagggcatg
gccaagaacacctacggcacgggctcttttatattgatgaataccggcagcgaaccgatc
acctcccagaccgggctgctgaccaccattgcctggggaaccgacagcggcgtcgagtat
gccctggaagggagtatctttattaccggggcagcggtgcagtggctgcgcgatgaactc
aaggtaatccacgacgctcgcgacagtgagtatttcgccaccaaggtggcggataacggc
ggggtgtatgtaatcccggcttttgccggcctgggggccccctactgggacatgtatgcc
cgcggcactatcgtcggcatgacccggggcaccaacatgaaccatattattcgcgccacc
ctcgagagtctggcctatcaggttcgcgatgtttccgagtgcatggcaaccgacagcggc
atagagatgcgcgaactcaaggccgacggcggggcatgcgccaatgactttatcatgcag
tatcagtcggacatcctcggggttccggttatccgcccaaaagtaatcgagaccactgcc
cgcggggctgccttcctggccgggctggcgaccggtttctggaaggatctgaaggacatt
caggcccataccgagatcgatcgggtattcgaaccctccatggacgccgaccagcgagag
gagctgtatcgcggctggcgacgcgctgtcgaccgctccagaggctggatcgaacaggcg
gagtag

DBGET integrated database retrieval system