KEGG   Spirochaeta africana: Spiaf_0325Help
Entry
Spiaf_0325        CDS       T01811                                 

Definition
glycerol kinase
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
sfc  Spirochaeta africana
Pathway
Glycerolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sfc00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    Spiaf_0325
Enzymes [BR:sfc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.30  glycerol kinase
     Spiaf_0325
Exosome [BR:sfc04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Spiaf_0325
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(402434..403939)
Genome map
AA seq 501 aa AA seqDB search
MDTRYILAFDAGTTSSRAILFDHDGNLAGTAQQEFPQIYPKPGWVEHDPMEIWATQSGVA
RQVLEKFGVRPDQIAGIGITNQRETAVVWDKNTGKPVYNAIVWQDKRTAGLCEQLRRDGM
TDTIRQKTGLVIDSYFSGTKIAWILENNPELRPRAEKGEILFGTVDTWLIWNLTRGKVHA
TDYSNASRTLLYNIHTLDWDDELLSALNIPRAMLPEVRPSSSIFGATDVRSFGAAEIPIA
GVAGDQQAALFGQGCFQKGMAKNTYGTGSFILMNTGSEPITSQTGLLTTIAWGTDSGVEY
ALEGSIFITGAAVQWLRDELKVIHDARDSEYFATKVADNGGVYVIPAFAGLGAPYWDMYA
RGTIVGMTRGTNMNHIIRATLESLAYQVRDVSECMATDSGIEMRELKADGGACANDFIMQ
YQSDILGVPVIRPKVIETTARGAAFLAGLATGFWKDLKDIQAHTEIDRVFEPSMDADQRE
ELYRGWRRAVDRSRGWIEQAE
NT seq 1506 nt NT seq  +upstreamnt  +downstreamnt
atggacacacgctacatcctggccttcgatgccggcacgacaagctcccgcgcgattctt
tttgatcacgacggcaacctggccggcactgcccagcaggaattcccgcagatatacccc
aaaccaggttgggtggaacatgatcccatggagatttgggctacccagagcggcgtcgcc
cgccaggtgctggagaaattcggggtacgccccgaccagatcgccggcatcggtatcacc
aatcagcgcgaaaccgccgtagtatgggacaagaacaccggcaagccggtgtacaacgcc
atagtgtggcaggataaacgcaccgccggtctgtgcgagcagctgcgccgggacggaatg
accgataccatccggcagaaaaccggcctggtaatcgactcctactttagcggcaccaag
attgcctggatcctggaaaacaaccccgaactgcgcccgcgtgccgaaaagggagagatc
ctgtttggcactgtcgacacctggctgatctggaacctgacccgcggcaaggtacatgcc
acggactactccaacgcctcgcgaacactcctgtacaatattcacaccctggactgggat
gatgagctgttgtccgccctgaacataccacgggccatgctgccggaggtccgcccctcc
agttcgatcttcggggccaccgacgtacgctcattcggcgccgccgagattccgattgca
ggggtggccggtgaccagcaggccgccctgttcgggcagggatgcttccagaagggcatg
gccaagaacacctacggcacgggctcttttatattgatgaataccggcagcgaaccgatc
acctcccagaccgggctgctgaccaccattgcctggggaaccgacagcggcgtcgagtat
gccctggaagggagtatctttattaccggggcagcggtgcagtggctgcgcgatgaactc
aaggtaatccacgacgctcgcgacagtgagtatttcgccaccaaggtggcggataacggc
ggggtgtatgtaatcccggcttttgccggcctgggggccccctactgggacatgtatgcc
cgcggcactatcgtcggcatgacccggggcaccaacatgaaccatattattcgcgccacc
ctcgagagtctggcctatcaggttcgcgatgtttccgagtgcatggcaaccgacagcggc
atagagatgcgcgaactcaaggccgacggcggggcatgcgccaatgactttatcatgcag
tatcagtcggacatcctcggggttccggttatccgcccaaaagtaatcgagaccactgcc
cgcggggctgccttcctggccgggctggcgaccggtttctggaaggatctgaaggacatt
caggcccataccgagatcgatcgggtattcgaaccctccatggacgccgaccagcgagag
gagctgtatcgcggctggcgacgcgctgtcgaccgctccagaggctggatcgaacaggcg
gagtag

DBGET integrated database retrieval system