KEGG   Spirochaeta africana: Spiaf_0462Help
Entry
Spiaf_0462        CDS       T01811                                 

Definition
uracil DNA glycosylase superfamily protein
Orthology
K10800  
single-strand selective monofunctional uracil DNA glycosylase [EC:3.2.2.-]
Organism
sfc  Spirochaeta africana
Pathway
Base excision repair
Brite
KEGG Orthology (KO) [BR:sfc00001]
 Genetic Information Processing
  Replication and repair
   03410 Base excision repair
    Spiaf_0462
Enzymes [BR:sfc01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.2  Hydrolysing N-glycosyl compounds
    3.2.2.-  
     Spiaf_0462
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(553939..555024)
Genome map
AA seq 361 aa AA seqDB search
MSEIDQTGAGDMESAGSEMLEEGDSGLAGGGSGRSPAGSEVLEEGDSGRSPASSEVLEEG
GQPDGGSPEAVALLTAARKLATVAGKLHFADPVAMTYNPLEYAWEGHADYVSRWGAGQKR
VVFLGMNPGPFGMAQTGVPFGEIAAVRDWMGVRGRIGHPPQEHPKRPVQGFACPKSEVSG
RRLWGLMQQRFGDAGEFFRDHFVVNYCPLIFMEASSRNRTPNQLKKPEREALFAVCDQHL
QSVLMALQPEWVVGVGKFAAERAARVVQAMAGGGAGRANSTGNFAGGETYSAGDGIGGTA
TRGSAGDTTGAARAADGTTSGPAAAVPRVTWVLHPSPASPHANRGWAEAAVRQLVDAGVW
V
NT seq 1086 nt NT seq  +upstreamnt  +downstreamnt
atgagcgagatcgaccagactggggctggtgatatggagagtgcgggcagcgaaatgctg
gaggaaggcgacagtggtttggcgggcggcggcagcggtagatcgccggcgggcagcgaa
gtgctggaggaaggcgatagcggtagatcgccggcaagcagcgaagtgctggaggaaggc
ggccagccagacgggggtagcccggaggccgttgccctgctgacggctgcccgcaagctg
gcaacagtagccgggaagctgcatttcgccgatccggtcgccatgacctacaacccgctg
gagtatgcctgggaggggcatgccgattatgtctcgcgctggggcgccgggcaaaaacgg
gtggtgtttctcggcatgaatccgggccccttcgggatggctcagaccggggtgccgttt
ggcgagatcgctgcggtacgggactggatgggggtacgcggccggattggccaccccccg
caggagcaccccaagcgtccggtgcaggggtttgcctgccccaagagcgaggtaagcggg
cggcgtttatggggccttatgcagcagcgtttcggggatgccggagagtttttccgggat
cattttgtggtaaactactgtccactgatattcatggaggcaagcagccgcaaccgtacc
cccaaccagctgaaaaagccggagcgcgaggcgctgtttgcggtgtgcgaccagcacctg
cagtcggtactgatggcgctgcagcccgagtgggtggtaggcgtcggcaagttcgccgcc
gagcgggccgcgcgggtggtgcaggcaatggctggcggtggcgcgggcagagcgaacagt
acaggtaatttcgcgggcggtgaaacgtacagcgcgggcgatggaattggcggcaccgcg
acgcgcgggtcggccggcgatacaactggcgcagccagagcggcagacgggaccaccagc
ggtccggcggcggcagtgccgcgggtaacctgggtgctgcaccccagcccggccagcccg
catgccaatcgcggctgggccgaggcggcggtccggcagcttgtcgatgccggtgtgtgg
gtgtag

DBGET integrated database retrieval system