KEGG   Spirochaeta africana: Spiaf_0466Help
Entry
Spiaf_0466        CDS       T01811                                 

Definition
galactose mutarotase
Orthology
K01785  
aldose 1-epimerase [EC:5.1.3.3]
Organism
sfc  Spirochaeta africana
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:sfc00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Spiaf_0466
   00052 Galactose metabolism
    Spiaf_0466
Enzymes [BR:sfc01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.3  aldose 1-epimerase
     Spiaf_0466
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
556659..557690
Genome map
AA seq 343 aa AA seqDB search
MEITKDRFGSAFDGTPVDIITISNSSGITLQCMSYGATLVSLKMPGRDGKLSDLVLGFDS
FDDYLKPHPYLGATIGRVAGRISKAQFSIGPRTFTLERNDGSNHLHGGRNGFDKVIWTPR
IFGDGDEVGVTFSRTSPDGEEGYPGKLDVEVTYALNDRNELAIRYRAESSKATPVNLTNH
TYWNLGGNGSILNHKLRINSKKYLPVDDNTIPMGDILETDGTPMDFSSAHPIGRDIKLVP
GGYDHCYVLPEAETRLRPAAILNHPESGRTMEVYTTKPGLQLYTANKLRDVVGKHGIHYG
KHSGVCLETMYFPDSVNQHDFPGIILRPKEEYHHETVHRFSIR
NT seq 1032 nt NT seq  +upstreamnt  +downstreamnt
atggaaataacaaaagacagattcggttccgcgttcgatggaaccccggtagatatcatt
accatctccaacagcagcgggattaccctgcagtgtatgtcctacggggctaccctggtg
tccctcaagatgcccggccgcgacggcaaactgagcgatctggtacttggcttcgacagt
ttcgatgactatctcaagccccacccgtatctcggggccaccatcgggcgggtcgccggg
cgcatcagcaaggcgcagttctccatcggcccgcgcacctttaccctggagcgtaacgac
ggcagcaaccatctgcatggcggccgcaacgggtttgacaaggtaatctggacaccccgg
atctttggcgacggcgacgaggtaggcgtgaccttctcgcgcaccagtcccgacggcgag
gaggggtaccccggcaagctcgatgtagaggtaacctacgccctgaacgaccgcaacgag
ctggctatccgctaccgtgccgaatcctccaaagcgaccccggtcaaccttaccaaccac
acctactggaatctgggcggcaacggctccatcctcaatcacaagctgcgcattaactcc
aaaaaatacctgccggtagatgacaacaccatcccgatgggcgacatcctggaaaccgac
ggcacccccatggatttttccagcgcccacccgatcggccgtgatatcaagctggttccc
ggcggctacgaccactgctatgtcctgcccgaagccgaaacccgactgcgcccggcagcc
atcctgaaccaccccgagtccggccgcaccatggaggtctacaccaccaagcccgggctg
cagctgtacaccgccaacaagctgcgggatgtggtcggcaaacacggcatccactacggc
aaacactccggcgtctgcctggagaccatgtactttcccgactcggtaaatcagcacgac
tttcccgggattatcctgcgccccaaggaagagtaccaccacgaaacggtacaccgcttc
tcgatccggtag

DBGET integrated database retrieval system