KEGG   Spirochaeta africana: Spiaf_0466Help
Entry
Spiaf_0466        CDS       T01811                                 

Definition
galactose mutarotase
Orthology
K01785  
aldose 1-epimerase [EC:5.1.3.3]
Organism
sfc  Spirochaeta africana
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Class
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:sfc00010]
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:sfc00052]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
556659..557690
Genome map
AA seq 343 aa AA seqDB search
MEITKDRFGSAFDGTPVDIITISNSSGITLQCMSYGATLVSLKMPGRDGKLSDLVLGFDS
FDDYLKPHPYLGATIGRVAGRISKAQFSIGPRTFTLERNDGSNHLHGGRNGFDKVIWTPR
IFGDGDEVGVTFSRTSPDGEEGYPGKLDVEVTYALNDRNELAIRYRAESSKATPVNLTNH
TYWNLGGNGSILNHKLRINSKKYLPVDDNTIPMGDILETDGTPMDFSSAHPIGRDIKLVP
GGYDHCYVLPEAETRLRPAAILNHPESGRTMEVYTTKPGLQLYTANKLRDVVGKHGIHYG
KHSGVCLETMYFPDSVNQHDFPGIILRPKEEYHHETVHRFSIR
NT seq 1032 nt NT seq  +upstreamnt  +downstreamnt
atggaaataacaaaagacagattcggttccgcgttcgatggaaccccggtagatatcatt
accatctccaacagcagcgggattaccctgcagtgtatgtcctacggggctaccctggtg
tccctcaagatgcccggccgcgacggcaaactgagcgatctggtacttggcttcgacagt
ttcgatgactatctcaagccccacccgtatctcggggccaccatcgggcgggtcgccggg
cgcatcagcaaggcgcagttctccatcggcccgcgcacctttaccctggagcgtaacgac
ggcagcaaccatctgcatggcggccgcaacgggtttgacaaggtaatctggacaccccgg
atctttggcgacggcgacgaggtaggcgtgaccttctcgcgcaccagtcccgacggcgag
gaggggtaccccggcaagctcgatgtagaggtaacctacgccctgaacgaccgcaacgag
ctggctatccgctaccgtgccgaatcctccaaagcgaccccggtcaaccttaccaaccac
acctactggaatctgggcggcaacggctccatcctcaatcacaagctgcgcattaactcc
aaaaaatacctgccggtagatgacaacaccatcccgatgggcgacatcctggaaaccgac
ggcacccccatggatttttccagcgcccacccgatcggccgtgatatcaagctggttccc
ggcggctacgaccactgctatgtcctgcccgaagccgaaacccgactgcgcccggcagcc
atcctgaaccaccccgagtccggccgcaccatggaggtctacaccaccaagcccgggctg
cagctgtacaccgccaacaagctgcgggatgtggtcggcaaacacggcatccactacggc
aaacactccggcgtctgcctggagaccatgtactttcccgactcggtaaatcagcacgac
tttcccgggattatcctgcgccccaaggaagagtaccaccacgaaacggtacaccgcttc
tcgatccggtag

DBGET integrated database retrieval system