KEGG   Spirochaeta africana: Spiaf_0482Help
Entry
Spiaf_0482        CDS       T01811                                 

Definition
6-phosphofructokinase
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
sfc  Spirochaeta africana
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:sfc00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Spiaf_0482
   01230 Biosynthesis of amino acids
    Spiaf_0482
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Spiaf_0482
   00030 Pentose phosphate pathway
    Spiaf_0482
   00051 Fructose and mannose metabolism
    Spiaf_0482
   00052 Galactose metabolism
    Spiaf_0482
  Energy metabolism
   00680 Methane metabolism
    Spiaf_0482
Enzymes [BR:sfc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     Spiaf_0482
Protein phosphatases and associated proteins [BR:sfc01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     Spiaf_0482
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(580846..581940)
Genome map
AA seq 364 aa AA seqDB search
MKLAINTGGGDAPGLNAVIRAVVSAAQQRGWECWGIREGYNGILEPQNFVDGGVVRLTRE
SVSGITHLGGTILGTTNKGNPLEYPVAAADGSLQTVDRCDEIIDYLKNQGFDALIAIGGD
GSLSVAHEIGERGGINVIGVPKTIDNDLKHTIATFGFDTAVTFATECIDRLHSTAESHRR
IMVVEVMGRYAGWIALESGVAGGADAVLIPEIPYDISRVAEKMRSRVDRGAAFSIVVVAE
GARPRDGQRAVKGTEIGRAERLGGIGDQVAAQLQELTGQEARCVVLGHLLRGGTPSARDR
LLSLRFGAAAVRALEEGQRHVMVSLHPPYVKYVPLTDVAHAMKLVPTDSDTVATARDMGI
SLGD
NT seq 1095 nt NT seq  +upstreamnt  +downstreamnt
atgaaactggcaatcaataccggcgggggagatgccccggggctgaacgccgttatccgg
gcagtggtgtcggcggcccagcagcgcggctgggaatgctggggcatccgcgaggggtac
aatggtatactggaaccgcagaattttgtcgatggcggcgttgtcaggctgacccgggaa
tcggtcagcgggattacccatctgggtggtacgattctgggaaccaccaacaaaggcaat
ccgctggagtacccggtagcagcagccgatggcagtctgcagaccgttgaccgctgtgac
gagatcatcgactatctgaagaatcaaggcttcgacgccctgatagccatcggcggtgac
ggctcgctgtcggttgcccatgaaatcggcgagcgcggcgggatcaatgtaatcggcgta
cccaaaaccatcgacaacgacctgaagcacaccatagcaacctttggctttgacacagcg
gtcacctttgcgaccgagtgcatcgaccggctgcacagtaccgccgagtcgcaccggcgg
attatggtggttgaggtgatgggacgctacgccggctggatcgctctggagtccggtgtt
gccggcggggcggatgccgtgctcatccccgagattccctatgatatatccagagttgcc
gagaagatgcgcagccgggttgaccggggggctgcgttttccattgtagtggtggccgag
ggtgcgcgcccccgggatggacagcgtgcagtaaaaggaacggagatcggccgcgccgag
cgactgggcgggatcggcgaccaggtcgctgctcagctgcaggaactgaccgggcaggag
gctcgctgcgtggtcctggggcatttgctgcgcggcggcacccccagtgcccgcgaccgc
ctgctctcgctgcgatttggcgcagcagcggttcgcgccctggaggagggccagcgtcac
gtaatggtgagtctgcatccaccctacgtcaagtatgtaccgttgacagacgtagcccat
gccatgaagctggtgccaacagacagcgacaccgtcgctaccgctcgcgatatgggaatc
agtttgggagattga

DBGET integrated database retrieval system