KEGG   Spirochaeta africana: Spiaf_0482Help
Entry
Spiaf_0482        CDS       T01811                                 

Definition
(GenBank) 6-phosphofructokinase
  KO
K21071  
ATP-dependent phosphofructokinase / diphosphate-dependent phosphofructokinase [EC:2.7.1.11 2.7.1.90]
Organism
sfc  Spirochaeta africana
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:sfc00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Spiaf_0482
   00030 Pentose phosphate pathway
    Spiaf_0482
   00051 Fructose and mannose metabolism
    Spiaf_0482
   00052 Galactose metabolism
    Spiaf_0482
  Energy metabolism
   00680 Methane metabolism
    Spiaf_0482
Enzymes [BR:sfc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     Spiaf_0482
    2.7.1.90  diphosphate---fructose-6-phosphate 1-phosphotransferase
     Spiaf_0482
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(580846..581940)
Genome map
AA seq 364 aa AA seqDB search
MKLAINTGGGDAPGLNAVIRAVVSAAQQRGWECWGIREGYNGILEPQNFVDGGVVRLTRE
SVSGITHLGGTILGTTNKGNPLEYPVAAADGSLQTVDRCDEIIDYLKNQGFDALIAIGGD
GSLSVAHEIGERGGINVIGVPKTIDNDLKHTIATFGFDTAVTFATECIDRLHSTAESHRR
IMVVEVMGRYAGWIALESGVAGGADAVLIPEIPYDISRVAEKMRSRVDRGAAFSIVVVAE
GARPRDGQRAVKGTEIGRAERLGGIGDQVAAQLQELTGQEARCVVLGHLLRGGTPSARDR
LLSLRFGAAAVRALEEGQRHVMVSLHPPYVKYVPLTDVAHAMKLVPTDSDTVATARDMGI
SLGD
NT seq 1095 nt NT seq  +upstreamnt  +downstreamnt
atgaaactggcaatcaataccggcgggggagatgccccggggctgaacgccgttatccgg
gcagtggtgtcggcggcccagcagcgcggctgggaatgctggggcatccgcgaggggtac
aatggtatactggaaccgcagaattttgtcgatggcggcgttgtcaggctgacccgggaa
tcggtcagcgggattacccatctgggtggtacgattctgggaaccaccaacaaaggcaat
ccgctggagtacccggtagcagcagccgatggcagtctgcagaccgttgaccgctgtgac
gagatcatcgactatctgaagaatcaaggcttcgacgccctgatagccatcggcggtgac
ggctcgctgtcggttgcccatgaaatcggcgagcgcggcgggatcaatgtaatcggcgta
cccaaaaccatcgacaacgacctgaagcacaccatagcaacctttggctttgacacagcg
gtcacctttgcgaccgagtgcatcgaccggctgcacagtaccgccgagtcgcaccggcgg
attatggtggttgaggtgatgggacgctacgccggctggatcgctctggagtccggtgtt
gccggcggggcggatgccgtgctcatccccgagattccctatgatatatccagagttgcc
gagaagatgcgcagccgggttgaccggggggctgcgttttccattgtagtggtggccgag
ggtgcgcgcccccgggatggacagcgtgcagtaaaaggaacggagatcggccgcgccgag
cgactgggcgggatcggcgaccaggtcgctgctcagctgcaggaactgaccgggcaggag
gctcgctgcgtggtcctggggcatttgctgcgcggcggcacccccagtgcccgcgaccgc
ctgctctcgctgcgatttggcgcagcagcggttcgcgccctggaggagggccagcgtcac
gtaatggtgagtctgcatccaccctacgtcaagtatgtaccgttgacagacgtagcccat
gccatgaagctggtgccaacagacagcgacaccgtcgctaccgctcgcgatatgggaatc
agtttgggagattga

DBGET integrated database retrieval system