KEGG   Spirochaeta africana: Spiaf_0688Help
Entry
Spiaf_0688        CDS       T01811                                 

Definition
4-alpha-glucanotransferase
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
sfc  Spirochaeta africana
Pathway
Starch and sucrose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:sfc00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(793424..794956)
Genome map
AA seq 510 aa AA seqDB search
MEHSTRPTELPRAAGILAHPTSLPGAYGIGTFGREARDFVDLLVLSRQRIWQMCPLGPTG
YGDSPYQCFSALAGNPLLIDVEQLVHDGLLAEHDLHSLTGFPTGHVDFGPVIEAKMQVLR
LAADTFFAKLGDPSTDVTAARFRRFCRDNAFWLDDYTLFMVLKAEFGGSAWSEWPDEQLR
MHEPQAVAAARERLQDEIRLHQFLQYIFFEQWLDLRAYANRSGIEIVGDMPIFVAYDSAE
AWAKPELFLFDEHHQPTSVAGVPPDYFSATGQLWGNPLYDWEYHEKTEFAWWIEIIRHKL
AMFDYLRIDHFRGFSAYWAVPFGDTTAERGEWQPARGRQLFRRIREVLGTPPILAEDLGF
ITDDVRRLKHEFGFPGMKILQFGFDSGQEMVNEFLPHNYEANCIAYTGTHDNDTLVGWLE
SAKPADRELAYEYLHSDGTRPHWDFIRGIYSSPAAFAIVPLQDILGLGKEARMNTPGTLG
GNWDWRFTQDMLKPDILQQLARLSELYGRI
NT seq 1533 nt NT seq  +upstreamnt  +downstreamnt
atggagcattcaacacgacctacagaactgccgcgcgcggccggtatactggcccaccca
accagcctgcccggggcgtatggaattggcaccttcggacgcgaagcccgtgattttgtc
gacctgctggtactgtcacgccagcggatctggcagatgtgcccgcttggcccgaccggg
tatggcgactcaccataccagtgcttttcggccctggcagggaacccgttgctgattgat
gtcgaacagctcgtccatgacggtctgctggccgagcacgatctgcacagtttaaccggt
tttcctaccggccatgtagactttggccctgtaatcgaggccaagatgcaggtgctgcgc
ctggccgccgacaccttttttgccaaactgggcgacccgtcaaccgatgtgaccgccgcc
cgttttcgccggttctgccgcgacaacgccttctggctggatgactacaccctgtttatg
gtgctgaaggccgagtttggcggttcagcctggtcggaatggcccgacgaacagctgcgt
atgcatgagccccaggcggtagccgctgcccgtgagcgcctgcaggacgagatccggctg
caccagtttttgcagtatatctttttcgagcagtggctggatctgcgcgcctatgccaat
cgcagcgggatcgagattgtcggcgacatgccgatctttgtcgcctacgactcggccgag
gcctgggccaagcccgaactgttccttttcgacgagcaccatcagcccaccagcgtggcc
ggggtgccgccggattacttcagcgctaccggccagctgtggggcaacccgctgtatgac
tgggagtatcacgaaaaaaccgagtttgcctggtggatcgagatcattcgccacaagctg
gcgatgttcgactacctgcgaatcgaccatttccgcggcttctccgcctactgggcggtc
ccgttcggagacaccaccgctgagcgtggtgaatggcagcctgccaggggacgccagctg
ttccgccgcatccgcgaggtgctgggcaccccgccgatcctggccgaggacctcggattt
attaccgacgatgtccgccgcctgaagcatgagttcggttttcccgggatgaagatcctg
cagttcgggttcgactcggggcaggaaatggtcaacgagttcctgccgcacaactacgag
gccaactgtatcgcctacaccggcacccacgacaacgacaccctggtgggatggctcgag
agcgccaaacccgcggaccgggagctggcctatgaatacctgcacagtgacggcacccgg
ccgcactgggactttatccgcgggatctacagcagccccgccgccttcgcgattgtcccg
ctgcaggatatcctggggctgggcaaggaagcccgcatgaacacccccggcaccctgggc
gggaactgggactggcgctttacccaggacatgctcaaaccggacatcctgcagcagctg
gcacgattgagcgagctgtacgggcggatatag

DBGET integrated database retrieval system