KEGG   Spirochaeta africana: Spiaf_0704Help
Entry
Spiaf_0704        CDS       T01811                                 

Definition
O-glycosyl hydrolase
Orthology
K01201  
glucosylceramidase [EC:3.2.1.45]
Organism
sfc  Spirochaeta africana
Pathway
Sphingolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sfc00001]
 Metabolism
  Lipid metabolism
   00600 Sphingolipid metabolism
    Spiaf_0704
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    Spiaf_0704
Enzymes [BR:sfc01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.45  glucosylceramidase
     Spiaf_0704
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
816899..818260
Genome map
AA seq 453 aa AA seqDB search
METRIIQTSQRAGGEIWQEVSALAAADALHPAAVITAGNPRRPDPMRGFGGAFTESAAWV
WSRLPQTEKQAVLTGYFDPVQGLGYRYGRTHMNSCDFSLGNYAAVDVPGDEKLWSFSCER
EKGCLWQFIHAAYDLQQEPIPLLLSPWSPPAWMKTNQEMNNGGSLLPEYRQAWARYFVRY
IAEMHKQGFRVFGVTVQNEPEATQTWDSCRYSAGDEAVFIRDHLGPALVQEDLQDVGIYF
WDHNRDLVYDRACEVLADPAVARYISGQAIHWYSGDQFDLVERTKREFPDKEMIFSEGCI
EGGVKLGEWDRGEIYAHNMIGDLNAGVTLWLDWNMLLDLQGGPNHVGNFCDAPMIADLDA
GQLHRQSSYAYIGHFSRYIQPGAVCLDFVMESETASAVETTVFRNPDGETVCVLLNRSDN
LENITVQGSHGSTSVSVALPAHSITTVLIANKE
NT seq 1362 nt NT seq  +upstreamnt  +downstreamnt
atggagacaagaatcattcaaaccagccagcgggccggcggagagatatggcaggaggtg
tctgcactggcagcggccgatgcactacaccctgccgcggttattaccgccgggaatccg
cggcgccccgacccgatgcggggttttggcggtgcgtttaccgagtccgccgcctgggtg
tggtcccggcttccgcagaccgagaagcaggcggtgctgaccggctattttgacccggta
cagggacttggctatcgctacgggcggacccatatgaacagctgtgacttttcgctgggg
aattacgctgcggtggatgtccctggcgatgagaagctgtggtcgttctcgtgcgagcgt
gaaaaagggtgtttgtggcagtttatccatgccgcctatgacctgcagcaggagccgata
ccgctgctgttgtcgccctggagcccccctgcctggatgaagaccaatcaggagatgaac
aatggcggctcgctcctgccggagtaccggcaggcatgggcacggtatttcgtgcgctat
atcgcagagatgcacaagcagggattccgggtgttcggggttaccgtgcagaacgagccg
gaggccacccagacctgggacagttgtcgctattctgccggggacgaggcggtgtttatc
cgggaccatctcggaccggctctggtgcaggaagacctgcaggatgtgggaatctatttc
tgggaccataatcgtgacctggtgtatgaccgggcatgcgaggtgcttgcagatccggct
gttgcccgctatatctccggccaggcgatccactggtactcgggggatcagttcgatctg
gtcgaacgtaccaagcgtgagttccccgacaaggagatgatcttctccgagggatgcatc
gagggcggggtcaagctgggagaatgggatcggggcgagatctatgcccataacatgatc
ggcgacctgaatgccggggtaaccctctggctggactggaatatgctgcttgatctgcag
ggtgggccgaaccacgtgggcaatttttgtgatgcccccatgattgccgacctggatgct
ggacagctgcatcgacagtcatcctatgcctatatcggtcatttcagccgctacatccag
ccgggggctgtctgtctcgattttgtgatggagagcgagactgccagtgcggtcgagacg
acggtgtttcgcaatccggacggggaaacagtatgtgtactcctgaaccgcagtgataat
ctcgagaatatcaccgtccagggatcgcacggcagcacgagcgtgtcggtagcactgcca
gcgcattcaataaccaccgtacttattgccaacaaggagtaa

DBGET integrated database retrieval system