KEGG   Spirochaeta africana: Spiaf_0893Help
Entry
Spiaf_0893        CDS       T01811                                 

Definition
glycosidase
Orthology
K01176  
alpha-amylase [EC:3.2.1.1]
Organism
sfc  Spirochaeta africana
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sfc00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Spiaf_0893
Enzymes [BR:sfc01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     Spiaf_0893
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1024820..1026937)
Genome map
AA seq 705 aa AA seqDB search
MRVYKYTVIWVFLAFLTAACSNPLQQASVQQDDSIPQSRTAQGSLPNIPDHMVNDTMYQF
FYWDSYPGLWSQITSSNTHLNRKAHELANAGITAVWLPPAAKGMAGGFSVGYDVYDFWDL
GEFDQKGTVGTRYGTRGQLEHAVSYLSNLGIDSYYDVVFNHRMGADSQQYVPGHGNVWTN
FDLQGRAHHYTQSRWGYLYHDIVWDWTAFNGIDGQLFPDKWWGNTFHDPYLMGNDVDYNR
QDIRHEMKAWGEWIINDIGFAGFRMDAVAHVDSDFVRRWVNHVQWATDQDIFYVAEAWVN
DVGGYLDHVGTGHLNAFDFSLRDDFVALSSGSKDMRWWGGLLNSPYGDRAVTFVDNHDTS
REGNPYNSPQVINYKNQAYAYILMRDRGVPTVFARDYDEFGMAPTLKKLIEARRYFAYGP
GHEYSGNQQHMYAYVREGLSDVPGTGLVMLLSGRDWGNQESYWINSRQPHTEFYDYTGNV
SGTVTTNEHGYGNFPVNITEGTGWSIWVPRTNSLTDISGNWAINQISYLYQNNYIQGYPD
GTYQPDGQLTRAEFAAFIASVLDPAAKPEYANRTFTDTSGHWAEQVILQAARAGYIAGYP
DGTFRPQETLSKLHATIALANGLGMSGGNGINLGSYLTDAHTIPTWARGSVKNALANNLL
VNYPLVNRFSPNVAIDRASIAALFYQVLVYQGTAPTLDSPYILTP
NT seq 2118 nt NT seq  +upstreamnt  +downstreamnt
atgagggtttataaatatacggttatctgggtattccttgcgtttctgacagctgcctgc
agcaatccgcttcagcaggcatcggttcaacaggacgacagcataccccagagtcgcact
gcacagggttcattgccaaatattcctgatcatatggtcaacgatacgatgtatcagttc
ttttactgggacagctacccgggtctctggagccagattacctccagcaatacacacctg
aaccgcaaagcccacgagctggccaacgccgggattaccgccgtctggctgccgccggca
gccaaaggcatggctggtggattcagcgtcggctacgatgtatatgacttctgggatctg
ggtgagttcgatcaaaagggtaccgtcggcacccgctacgggacccgcgggcagcttgag
catgcggtaagctacctgagcaacctgggcatcgactcatattacgacgtggtattcaac
caccggatgggtgccgacagccagcagtatgtccccggacacggcaatgtatggaccaat
tttgatctgcaaggtcgtgctcaccactatacccaaagccgctggggctacctgtaccac
gatatcgtctgggactggaccgcatttaacggcatcgacgggcagctgttccccgataaa
tggtggggtaacacctttcacgacccgtatctgatgggcaacgatgtagactacaaccgc
caggacattcgccacgaaatgaaagcctggggcgagtggattatcaacgatatcgggttt
gccggcttccgcatggatgccgtagcccatgtcgacagcgactttgtacgccgctgggtt
aaccatgtacagtgggcaaccgatcaggatattttttatgttgccgaggcctgggtgaac
gacgtcggcggctacctggatcatgtaggcacagggcacctgaacgcctttgacttcagc
ctgcgggatgactttgtcgcactttccagcggcagcaaggacatgcgctggtggggcgga
ttgcttaacagcccctacggagaccgtgcggtcacctttgtcgataatcacgacaccagc
cgtgaaggcaatccgtataactcaccccaggtgatcaactacaagaatcaggcctacgcc
tacattctgatgcgagaccgcggtgtaccaaccgtctttgcccgcgattacgacgagttc
ggcatggcccccaccctgaaaaagctgatcgaggctcgccgttactttgcctacgggcct
ggtcatgagtacagcggtaaccagcagcacatgtatgcctatgtgcgcgaaggattatcc
gacgtaccgggaaccggtctggttatgctgctttccggccgcgactggggcaatcaggaa
agctactggataaattcgcgccagccacacaccgagttctacgactacaccggcaacgta
agcggtacggtaaccaccaacgagcacgggtacggaaactttccggtgaacattaccgaa
ggaaccggctggtcgatctgggttccccgcaccaacagcctgaccgacatttcggggaac
tgggccataaaccagatctcttacctttaccagaacaactatattcagggctatcctgac
ggcacctaccagccagacggccagctgacccgggccgagtttgccgcatttatcgccagt
gtactcgaccctgccgccaaacccgaatatgccaaccgcaccttcaccgacaccagcggg
cactgggcagagcaggtaatactgcaggccgctcgggccggctacattgccggctaccca
gacggcacctttcgcccccaggagaccctgtccaagctgcatgccacaattgccctggca
aacggcctgggcatgagcggcggcaacggcattaacctgggctcataccttaccgatgca
cacaccattcccacctgggccaggggctcggtaaaaaatgcgctcgccaacaacctgctg
gttaactacccgctggtgaacaggttttcccccaacgtggcgattgatcgggcatcgatt
gcagccctgttctatcaggtactggtgtatcagggaaccgcaccaacgctggattcgccc
tatatcctgacaccctga

DBGET integrated database retrieval system