KEGG   Spirochaeta africana: Spiaf_0967Help
Entry
Spiaf_0967        CDS       T01811                                 

Definition
inositol monophosphatase/fructose-1,6-bisphosphatase family protein
Orthology
K01082  
3'(2'), 5'-bisphosphate nucleotidase [EC:3.1.3.7]
Organism
sfc  Spirochaeta africana
Pathway
Sulfur metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:sfc00001]
 Metabolism
  Energy metabolism
   00920 Sulfur metabolism
    Spiaf_0967
Enzymes [BR:sfc01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.7  3'(2'),5'-bisphosphate nucleotidase
     Spiaf_0967
Transfer RNA biogenesis [BR:sfc03016]
 Eukaryotic Type
  tRNA degradation factors
   Rapid tRNA decay (RTD) pathway factors
    Spiaf_0967
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1120565..1121497
Genome map
AA seq 310 aa AA seqDB search
MHELYTRLPELKDRAMQAARAAGRVIMDCRSGDLAVRLKESGYSRASRILTRADAESQEI
LLARLLSGDDYPEIGLLSEETPDDLSRLHHECFWAVDPLDGTLAFAEAGSGFAISIALVS
RTGQPLLGVVHDPVARQSWWAVAGQGAWLRKDDTGHTVPLQLQSRKGRQDAAGSLNIYLD
QGFREPPGWARIEFGLDRIAVELGYAGGVFHRGGGAVLNGVQALFDGGCYFKSPKSQQGG
GCIWDYAATVCLASEAGGWCSDAAGQPLQLNNPASVFLNHCGVVYAGDAQLGRAVVALLG
SQVADQDIRK
NT seq 933 nt NT seq  +upstreamnt  +downstreamnt
atgcatgagctctatacccggctgccagagctgaaggatcgtgccatgcaggctgcccgg
gccgccgggcgggtgatcatggactgcaggtccggggaccttgcggtgcgcctgaaggaa
tccggttacagtcgggcctcacgcatccttacccgtgccgatgccgaaagccaggagatt
ctgctggcgaggctgctgtccggcgacgattacccggagatcgggctgttaagcgaggaa
acccccgatgatctcagccggctgcatcatgagtgcttctgggcggtcgatcccctggac
ggtaccctggcctttgccgaggccggcagcggatttgcgatttcgattgccctggtttcc
cgtaccgggcagccactgctcggggtggtacacgatccggttgcccggcagtcatggtgg
gcggttgccggtcagggggcatggctgcggaaggatgatacggggcacacggtaccgctg
cagctgcagtcgaggaaagggcggcaggacgctgctggttccctgaacatctatctggat
cagggatttcgggaaccgcctgggtgggcccggattgagttcgggctggacaggattgcc
gtcgagctggggtatgccggtggggtttttcaccggggcggcggtgccgttctgaatggg
gtacaggcgttattcgatggggggtgttatttcaaatctcccaagtcgcagcagggtggc
ggctgtatatgggactatgccgccacggtatgccttgccagcgaggcaggcggatggtgc
agcgatgctgccggacagccgctgcagctgaacaatcctgcctcggtgtttctgaatcac
tgcggggtggtgtacgccggtgatgcgcagctgggcagggcggtggtggcgctgctgggc
agtcaggtagccgatcaggatataagaaaataa

DBGET integrated database retrieval system