KEGG   Spirochaeta africana: Spiaf_1278Help
Entry
Spiaf_1278        CDS       T01811                                 

Definition
(GenBank) glucokinase
  KO
K00845  glucokinase [EC:2.7.1.2]
Organism
sfc  Spirochaeta africana
Pathway
sfc00010  Glycolysis / Gluconeogenesis
sfc00052  Galactose metabolism
sfc00500  Starch and sucrose metabolism
sfc00520  Amino sugar and nucleotide sugar metabolism
sfc00521  Streptomycin biosynthesis
sfc01100  Metabolic pathways
sfc01110  Biosynthesis of secondary metabolites
sfc01120  Microbial metabolism in diverse environments
sfc01130  Biosynthesis of antibiotics
sfc01200  Carbon metabolism
Module
sfc_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
sfc_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:sfc00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Spiaf_1278
   00052 Galactose metabolism
    Spiaf_1278
   00500 Starch and sucrose metabolism
    Spiaf_1278
   00520 Amino sugar and nucleotide sugar metabolism
    Spiaf_1278
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Spiaf_1278
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    Spiaf_1278
Enzymes [BR:sfc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     Spiaf_1278
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glucokinase ROK
Motif
Other DBs
NCBI-ProteinID: AFG37353
UniProt: H9UIL0
Position
complement(1462955..1464001)
Genome map
AA seq 348 aa AA seqDB search
MNAETVIVAGDVGGTNTTIALMAPEGNSFRIVRKQRYSSQQLSGIEEAISDSLEGFRRDH
PDLKLTACCFSAAGPVRDNRCKLTNVPWSVDGAVISELFGAPAFVINDFSAVCYGLPLLQ
LDNPEEVTVLQHPDGSIPEPHGDVMAAAGAGTGLGVGFLIRNGDHVRAFPTEAGHVDLAP
VDDTMSDFYRFLRAELNGQRPGAELSISGMGISNLYRFFRSKLDGPVDDQLARIDDAAVT
ERPPLISRGAADGHPLLQQVMRYFVQMYANFASNAALNYIPSAGLFLAGGIAAKNQQFFL
EDDLFMRTFLENYNPNIRTVIERIPVYIIRNYDVSLYGAANAARMLKE
NT seq 1047 nt NT seq  +upstreamnt  +downstreamnt
atgaacgcagaaaccgttattgtagccggagatgtcggcggaaccaacacaaccattgcc
ctgatggctccggagggcaactcgtttcggattgtgcgcaagcagcgctactcctcccag
cagctttcgggtatcgaagaggccatcagcgattcgctcgaaggctttcggcgcgatcat
cccgacctcaagctgaccgcctgctgtttcagtgccgctggtccggtacgcgacaaccgc
tgcaaactgaccaatgtgccctggtcggtcgacggcgcggtgatcagcgaactgttcggc
gcaccggcctttgtcatcaatgatttctcggcggtatgttacggactgccgctgctgcag
ctcgacaatccggaagaggttactgttctgcagcaccccgacggcagcataccggagcct
catggcgatgtcatggcggcagcgggagccggcactggtctgggcgtcggttttctgatc
cggaacggcgatcatgtacgggccttccctaccgaggctgggcatgtcgatctggcaccg
gtcgacgacaccatgagtgatttttaccggttcttgcgtgctgaactgaatggacagcgc
cccggtgcggagctgtcgatctccggaatggggatatccaacctgtatcgcttctttcgg
tcaaaactggacggaccggtcgatgatcagcttgccaggatagacgacgctgcggttacc
gagcgcccgccactgatcagccgcggcgcagcagacggccacccgcttctccagcaggtt
atgcgctacttcgttcagatgtacgccaattttgcctctaacgctgcgctaaactacatt
ccctcggccggtctgttcctggctggcggaatcgccgccaagaaccagcagtttttcctc
gaggacgatctgtttatgcgtacattcctcgagaactataacccgaatatccgcacggta
atcgagcggataccggtatatatcattcgtaactacgatgtctccctgtacggtgcggcc
aacgccgcccgcatgctaaaggagtaa

DBGET integrated database retrieval system