KEGG   Spirochaeta africana: Spiaf_1520Help
Entry
Spiaf_1520        CDS       T01811                                 

Definition
(GenBank) 2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase
  KO
K00950  2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:2.7.6.3]
Organism
sfc  Spirochaeta africana
Pathway
sfc00790  Folate biosynthesis
sfc01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sfc00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Spiaf_1520
Enzymes [BR:sfc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.6  Diphosphotransferases
    2.7.6.3  2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase
     Spiaf_1520
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HPPK
Motif
Other DBs
NCBI-ProteinID: AFG37579
UniProt: H9UJ86
Position
complement(1736240..1736827)
Genome map
AA seq 195 aa AA seqDB search
MTNCSDASDPESRVQVACSVGGNLPGTWQAFGWLSRALPSHFMDLRCSQVYRTAPQGYSD
QPDFLNWAFVGWSRLGVQQLLRQLLQLEQQAGRIRKMPNGPRILDIDLLLYGSEKVYTPE
VTVPHPRMHLRAFALVPLLELWPAAQDPRTGTPVAEYLANLAGQGIYSLGIYPYNRETHG
STRSGITASFPAKGF
NT seq 588 nt NT seq  +upstreamnt  +downstreamnt
atgacgaactgttctgacgccagtgatccggagagccgggtgcaggtggcctgcagtgtc
ggcggcaatctgccgggcacctggcaggcattcggctggctcagcagggcactcccgtcg
cactttatggatctgcgttgttctcaggtctatcggactgccccgcagggatacagcgac
caaccggattttctgaactgggcctttgttggctggagcaggctcggggtgcagcagctg
cttcggcagttgctgcagctggaacagcaggccgggcggatacggaagatgcccaatggc
ccgcgtatcctggatatcgatctgctgctgtacgggtcggaaaaagtttacaccccggag
gtgaccgtgccccatccacggatgcatctgcgcgcatttgcattggtgccgctgctggag
ctgtggccggccgcacaggacccccgtaccggtacccctgtggctgaatatcttgcaaat
cttgccgggcagggtatttactccctcggtatctacccgtataatcgggagacccatgga
agcacacgaagcggaatcactgcatcgtttccggctaagggattttga

DBGET integrated database retrieval system