KEGG   Spirochaeta africana: Spiaf_1552Help
Entry
Spiaf_1552        CDS       T01811                                 

Definition
Holliday junction DNA helicase subunit RuvA
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
sfc  Spirochaeta africana
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:sfc03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1777332..1777943)
Genome map
AA seq 203 aa AA seqDB search
MIESLSGKISATAVHGIHLQCGPVEWEILASTRTIRDMAARTGQEVRLHTHLIVREDDLK
LFGFSDRKERELFRALIGVSGIGAKQAIRILSFSPPTDLARFIEGADIESLGRIPGIGKK
TAQKMVLALQGELVTEPDAAERGDDFSEIIESLVSMGFDKAAVRKTVATCAAGPAGAESS
PRVREQNIFRTALLELSTREQGG
NT seq 612 nt NT seq  +upstreamnt  +downstreamnt
atgatagaaagtctgagcggaaaaatcagcgccactgcggttcacgggattcatctgcag
tgcggaccggtggagtgggagatccttgccagcactcgtaccatacgtgatatggctgcc
agaaccgggcaggaggtgcggctgcacacccacctgattgtgcgcgaggacgatctcaag
ctgttcgggttttccgatcgcaaggagcgcgaactgtttcgtgcccttatcggggtttcc
ggcatcggtgccaagcaggctatcagaattctgtccttcagcccgccgactgacctggcc
aggtttatcgagggagctgatatcgagtccctggggcggattcccggtatcggtaaaaaa
actgcccagaagatggtgctggcactgcagggtgagctggtaaccgaaccggatgctgcc
gaacgcggtgacgatttctccgagatcatcgagtcactggtgagtatggggttcgacaag
gctgcggtgcgcaagactgttgctacctgtgctgccggtccggcaggggcggagagctcg
ccccgggtgcgggagcagaacatcttccgcaccgcactgctggagctgtcgacccgcgag
cagggagggtag

DBGET integrated database retrieval system