KEGG   Spirochaeta africana: Spiaf_1631Help
Entry
Spiaf_1631        CDS       T01811                                 

Definition
(RefSeq) triosephosphate isomerase
  KO
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
sfc  Spirochaeta africana
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:sfc00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Spiaf_1631
   01230 Biosynthesis of amino acids
    Spiaf_1631
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Spiaf_1631
   00051 Fructose and mannose metabolism
    Spiaf_1631
   00562 Inositol phosphate metabolism
    Spiaf_1631
Enzymes [BR:sfc01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     Spiaf_1631
Exosome [BR:sfc04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   Spiaf_1631
  Exosomal proteins of bladder cancer cells
   Spiaf_1631
  Exosomal proteins of melanoma cells
   Spiaf_1631
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1845060..1845815)
Genome map
AA seq 251 aa AA seqDB search
MRPYFLAGNWKLHKTPSEAVAYAKELAEAFASVTHRVMVAPTYVCIPQVAEVLKGSPVLV
GAQNCAAAESGAHTGEVAPAMLKEAGVDVVILGHSERRSIYGESDETINQKVKLALSAGL
EVILCVGETLDEREAGKAMQVVEDQLRKGLAGITGDQLDKITIAYEPVWAIGTGKTATPQ
DANEIHQGAREVLADIYSTEAAEAMVIQYGGSVKPANVKELMAMEHIDGALVGGASLTIE
NFAPIVQFDKE
NT seq 756 nt NT seq  +upstreamnt  +downstreamnt
atgagaccatattttttagcaggaaactggaagctgcataaaacccccagcgaggcagtg
gcctacgcgaaagagctggccgaggcatttgcctcggtaacccatcgggtaatggtggcc
cctacatacgtatgtatcccgcaggttgccgaggtgctgaaaggctctccggtactggta
ggtgcgcagaactgcgctgctgccgagagtggcgcacataccggggaggttgccccggcg
atgctcaaggaagccggcgtcgatgtcgtaatcctgggtcactcggagcgtcgttcgatt
tatggcgagagcgatgaaacaatcaaccagaaggtgaaactggcgctgtcagccgggctc
gaggttattctctgtgtcggggagaccctcgacgagcgggaagccggtaaagccatgcag
gtggtcgaggatcagctgcgcaaggggctggccgggatcaccggtgatcagcttgacaag
atcaccattgcatacgaaccggtatgggcgatcggtaccgggaaaactgcaacaccgcag
gatgccaacgagattcaccagggtgcccgcgaagtcctggctgatatctacagcacagaa
gcggcagaggctatggttattcagtatggtggttcggtaaagccggctaacgtaaaagaa
cttatggcgatggagcatattgatggggccctggtcggtggcgcaagccttaccatcgag
aactttgctcctatcgtgcagtttgacaaggagtag

DBGET integrated database retrieval system