KEGG   Spirochaeta africana: Spiaf_1829Help
Entry
Spiaf_1829        CDS       T01811                                 

Definition
protein-L-isoaspartate and D-aspartate O-methyltransferase
Orthology
K00573  
protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
sfc  Spirochaeta africana
Brite
Enzymes [BR:sfc01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.77  protein-L-isoaspartate(D-aspartate) O-methyltransferase
     Spiaf_1829
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2096781..2097431
Genome map
AA seq 216 aa AA seqDB search
MQQLPRRHQDRTRLLQELQQDGIRDHRVLEAMAAIPRELFIEPGLADQAYANRPLSIGYG
QTISQPYTVAFMAELLRLQPGMRVLEIGGGCGYSAAILGQLVRPGGIVYSLERLPSLAER
GRRNLTACGSDEVRLRAADGSEGLPEHAPYDAIVIAAAAVHIPPRLQHQLGEHGRLLLPL
QPPGHHAAEMTLIERRGDSFISSSHGLFQFVPLIFP
NT seq 651 nt NT seq  +upstreamnt  +downstreamnt
atgcagcagctaccccgacggcaccaggatcgcacccgtctgctgcaggagctgcagcag
gacggaatccgtgaccatcgcgtacttgaagcgatggcggccatcccccgtgagctgttt
attgaacccggtcttgccgaccaggcctacgccaaccgaccactatcaatcgggtatggg
caaaccataagccagccctataccgtcgcctttatggctgaactgctcaggctgcagccg
ggaatgcgggttctggagatcggcggtggctgcggctacagcgccgcaatactgggccag
ctggtaaggcctggcgggatcgtctacagtctggagagactgccatccctggccgagcgc
ggccgccgcaacctgacggcctgcggcagcgatgaggtcagactgcgtgctgccgacggc
agcgaagggctgcccgagcacgccccgtatgacgctattgttatcgctgccgctgccgtt
catattcccccccgactgcagcatcagctgggtgagcacggtcgtctgttgctcccacta
cagcccccgggacaccacgcggcagagatgaccctgattgaacgccgcggcgacagtttt
atatccagcagtcacggcctgttccagtttgtccccctgattttcccttga

DBGET integrated database retrieval system