KEGG   Spirochaeta africana: Spiaf_2331Help
Entry
Spiaf_2331        CDS       T01811                                 

Definition
xylose isomerase
Orthology
K01805  
xylose isomerase [EC:5.3.1.5]
Organism
sfc  Spirochaeta africana
Pathway
Pentose and glucuronate interconversions
Fructose and mannose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sfc00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Spiaf_2331
   00051 Fructose and mannose metabolism
    Spiaf_2331
Enzymes [BR:sfc01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.5  xylose isomerase
     Spiaf_2331
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2635453..2636766
Genome map
AA seq 437 aa AA seqDB search
MKSELFPEIPVIPFEGPQSRNPCAFKHYDPDELVGGKPMKDHLRFSMAFWHTMNAGGTDP
FGAPTAIRPWDGETDPMRIAELKMRGLFELTGKLNIPYFCFHDTDIAPAGATLRESHRNL
DHITGLIKQLQQDSPLQLLWGTANLFTHPRYMHGAATSPDTRVYAYAAGQVRKAIEVTKE
LNGENYVFWGGREGYETLLNTDMKRELDNLARFMHMAVDYAREIGFTGQFLFEPKPKEPT
KHQYDTDSATVHAFLQAYDLLPHVKLNIETNHATLAGHTIQHELQYARIHGILGSVDANQ
GDTLLGWDTDQFPTDLYTTTLMMYEILKNGGLHRGGLNFDAKVRRPSNTIRDVVVSHIVG
MDSFARGLKAAHAMLQDRALEGFIDTRYASWDEPLGREIQSGTTTLQSLEQQIIDLPQFL
PDSGQQEYLESLINGYL
NT seq 1314 nt NT seq  +upstreamnt  +downstreamnt
atgaagtcagaacttttcccggagattccggttattccgtttgaaggaccccaaagcagg
aacccgtgtgcattcaagcactacgaccccgatgagctggtcggcggcaagccgatgaaa
gaccacctccgtttctcgatggccttctggcacaccatgaacgccggcggcaccgacccg
tttggtgccccgaccgccatacgcccctgggacggggagaccgatcccatgcggattgcc
gagctcaagatgcgcggcctgttcgaactcaccggaaagctcaacatcccctatttctgc
tttcatgacaccgacattgcaccggctggcgccaccctgcgggaatcacacaggaacctg
gatcatatcaccggattgatcaagcagctgcagcaggacagtcctctgcagctgttatgg
ggtaccgccaatctctttacccatccgcgctacatgcacggggccgctaccagtcccgat
acccgggtgtatgcctatgctgccggtcaggtgcgcaaggcaatcgaggttaccaaggag
ctgaacggggaaaactacgtgttctggggcggccgggagggctacgaaaccctgctgaac
accgatatgaagcgcgaactcgacaacctggccaggttcatgcacatggccgtggactat
gcccgggagatcgggttcaccggtcagtttctgttcgaaccaaagcccaaggaacccacc
aagcatcagtacgacaccgacagcgccaccgtacatgccttcctgcaggcctatgacctg
ctcccgcatgtaaagctcaacatcgaaaccaatcatgctaccctggctggtcacaccatc
cagcacgagctgcagtacgcccggatacacgggatcctcgggagtgtcgatgccaaccag
ggcgacaccctgttgggctgggacaccgaccagtttcccaccgatctgtacaccactacc
ctgatgatgtacgagatcctgaagaacggcggcctgcaccgcggcggtctgaactttgac
gccaaggttcgacgcccctcgaacaccatccgtgacgtggtcgtcagccatatcgtgggc
atggacagctttgcccgcggactgaaggcagcccacgccatgctgcaggatcgggccctc
gaagggtttatcgacacccgctatgcctcgtgggacgaacccctgggacgcgaaatccag
tccggcacaaccacgctgcaatcgctggagcagcaaattattgacctcccgcaattcctg
cccgattccggtcagcaggagtatctggaaagcctgatcaacgggtatctgtaa

DBGET integrated database retrieval system