KEGG   Spirochaeta africana: Spiaf_2356Help
Entry
Spiaf_2356        CDS       T01811                                 

Definition
1,4-alpha-glucan-branching protein
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
sfc  Spirochaeta africana
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Trehalose biosynthesis, D-glucose 1P => trehalose
Brite
KEGG Orthology (KO) [BR:sfc00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Spiaf_2356
Enzymes [BR:sfc01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.18  1,4-alpha-glucan branching enzyme
     Spiaf_2356
Exosome [BR:sfc04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Spiaf_2356
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2666415..2668415
Genome map
AA seq 666 aa AA seqDB search
MKKILLIILAAALLAACDVTGSSSDDTDNGNGSSPTNGGDTSAPPPERDYEVRNREAAED
YNLTEVFAGDYVMPGPTDLGNGKFLFVLPDTVWNQVWLAGDMTGWADSPIEMAFDEVQGY
WWVVAEAEVGDEYRFILNDPTWDADDQWISDPYGRAFRNDGSNTILIDTDYNWTTSNYSR
PAREDLIIYEMHMDDFTREDSAYDSINGIIMRAKEKIPYLVELGINAVEIMPVQHWPGGW
YSWGYNNSGYFAIESSLGSEEHLAYTEFKEFVDALHAEGIAVILDVVYNHTSNDDNWLWT
MDSDTYFAGSTPWGNRLDFTQDATRKFFLDNMKFLLDEFRIDGFRFDATDYIDLNNGLLP
LIQQLVDNGYDDVYYIFEQFQGSNDNKIGAFNDTNGRTIISSWGANFKIPAWSALDNQRA
GNLPVWPDTLGAPTFFNNDRGWVSRPTDVVNFVSSHDEGTLRSQHTNTHLDFRFNRNQVA
LGHTHMFTSMGIPMMWMGDEIQRIHYGNMTPQNGFPYDNIDINANTVEWDDLYNNAADTD
DSLRMLEYFKGLIALRSGNANLRRSSNPGDEFGWAYGPWDGPTNQVIAYWYDNGDDPALL
IALNYGSGSHTIDVTGLPRNGEWTGIADSTELNINLADGIGTSLDVFDDSASLTLSAHQA
LIFRYE
NT seq 2001 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaagatattactgattatactggcagccgctttgctggctgcgtgtgacgtaacg
gggtcgagctccgatgacaccgacaacggaaacggcagcagccctaccaacggcggtgat
acatcagcgccaccacccgagcgcgattacgaggttcgtaatcgcgaggcagccgaggac
tataatcttaccgaggtctttgccggagattatgtcatgcccgggcctaccgaccttggc
aacggcaagttcctgtttgtcctgccggacaccgtctggaaccaggtctggctggccggc
gacatgacaggctgggctgattcaccaatagagatggcctttgacgaggttcagggttac
tggtgggtggttgccgaggccgaggttggcgatgaatatcgctttatcctgaacgacccc
acctgggatgcagatgaccagtggatcagcgacccctacggcagggcattccgcaacgac
ggcagcaataccatcctgatagacaccgactacaactggaccacaagcaattattcccgg
cctgcacgcgaagatcttattatctatgagatgcacatggatgactttacccgggaagat
tcagcttatgactccatcaacgggattatcatgcgtgccaaggaaaagatcccgtacctg
gtggagctcggcatcaacgccgtggagattatgccggtacagcactggccgggaggctgg
tattcctgggggtacaacaactccgggtattttgcaattgagtcctcgctgggcagcgag
gagcacctggcctacaccgagttcaaggagtttgttgacgcactgcatgcagagggcatc
gcggttatcctggatgtggtctacaatcacacctccaatgatgacaactggctgtggacc
atggatagcgacacctattttgccggcagcaccccctggggcaaccggctggactttacc
caggatgccacccggaagttctttcttgataacatgaagttcctgctggatgagttccgc
atcgacggattccgcttcgatgctaccgattatatcgacctcaacaatggcctgctgccg
ctgatacagcagctggtggataacggctacgacgatgtatattacatcttcgagcagttc
caaggctctaacgataacaagatcggagcttttaacgataccaacgggcgcaccatcatc
agcagctggggtgccaacttcaagattccagcgtggtcggcgctggataatcagcgtgca
ggtaatctgcccgtatggccagacacgcttggcgcgcctaccttctttaacaacgatcgc
ggctgggtatcacgccccacagacgtggtgaacttcgtgtcctcgcatgacgagggaacc
ctgcgatcccagcacaccaatacccaccttgattttcgctttaatcgaaaccaggtggcg
ctgggacacacccatatgtttacctctatgggtatcccgatgatgtggatgggcgatgaa
atccagcgcattcactacggcaacatgacaccgcaaaacggcttcccctacgacaacata
gatataaacgcgaataccgtagaatgggacgatctgtacaacaacgcagcagacaccgat
gacagcctgagaatgctggagtatttcaaaggtctgattgcactgcgcagcgggaacgcc
aatctgcgccgcagctccaatcccggggatgagtttggttgggcgtacggtccctgggac
ggccccaccaatcaggtgatagcctactggtacgataacggggacgatcctgccctgctg
attgccctgaactatggcagcggaagccacactattgatgtgaccggtcttccccggaat
ggcgagtggaccggcatcgctgactccacggagctgaatataaatcttgcagatggcatt
ggcaccagtctggatgtgtttgatgattccgcatctctgaccctgtcggctcatcaggcc
ctgatattccgctacgaataa

DBGET integrated database retrieval system